Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
53044 | 275 | 12 | P0DTC3(AP3A_SARS2) | RecName: Full=ORF3a protein; Short=ORF3a;AltName: Full=Accessory protein 3a;AltName: Full=Protein 3a;AltName: Full=Protein U274;AltName: Full=Protein X1; |
QUERYSEQ |
MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWH TNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL |
275 | region | name | description |
1-275 | CHAIN | /note="ORF3a protein" /id="PRO_0000449650" | |
1-42 | TOPO_DOM | /note="Extracellular" | |
43-61 | TRANSMEM | /note="Helical" | |
62-67 | TOPO_DOM | /note="Cytoplasmic" | |
68-93 | TRANSMEM | /note="Helical" | |
94-101 | TOPO_DOM | /note="Extracellular" | |
102-126 | TRANSMEM | /note="Helical" | |
127-275 | TOPO_DOM | /note="Cytoplasmic" | |
33-141 | DOMAIN | /note="CoV 3a-like viroporin TM" | |
145-237 | DOMAIN | /note="CoV 3a-like viroporin CD" | |
1-39 | REGION | /note="Disordered" | |
239-275 | REGION | /note="Disordered" | |
1-275 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
275 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7kjr | B | 100.0 | AP3A_SARS2 ORF3a protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
275 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8equ[2] | C | SAP_HUMAN Saposin-A[80 aa] | A | 100.0 /100.0 |
7 /7 |
AP3A_SARS2 ORF3a protein | |
8equ[2] | F | SAP_HUMAN Saposin-A[80 aa] | A | 100.0 /100.0 |
1 /1 |
AP3A_SARS2 ORF3a protein | |
8equ[2] | D | Saposin A, polyalanine model[79 aa] | A | 100.0 /100.0 |
1 /1 |
AP3A_SARS2 ORF3a protein | |
7kjr[4] | C | APOA1_HUMAN Apolipoprotein A-I[31 aa] | A | 100.0 /100.0 |
6 /6 |
AP3A_SARS2 ORF3a protein | |
7kjr[4] | D | APOA1_HUMAN Apolipoprotein A-I[31 aa] | A | 100.0 /100.0 |
6 /6 |
AP3A_SARS2 ORF3a protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
275 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7kjr[10] | E |
PEE
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine[23 a.. |
A | 100.0 /100.0 |
4 /4 |
AP3A_SARS2 ORF3a protein | |
7kjr[8] | F |
PEE
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine[23 a.. |
A | 100.0 /100.0 |
4 /4 |
AP3A_SARS2 ORF3a protein | |
8eqj[6] | D |
PEE
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine[22 a.. |
A | 100.0 /100.0 |
7 /7 |
AP3A_SARS2 ORF3a protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
275 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xdc[10] | B | AP3A_SARS2 ORF3a protein[193 aa] | A | 100.0 /100.0 |
42 /42 |
AP3A_SARS2 ORF3a protein | |
8eqs[2] | B | AP3A_SARS ORF3a protein[192 aa] | A | 83.3 /76.6 |
48 /48 |
AP3A_SARS ORF3a protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |