#WARNING:no index is registered index "YP_009724392.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724392.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[30 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2694837 75 18 YP_009724392.1()
QUERYSEQ
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724392.1()]

75
region name description

MONOMER
75
pdb_id a1 identity[%]2 description
2mm4 A 91.4 VEMP_CVHSA Envelope small membrane protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HOMO
75 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k3g[22] B VEMP_SARS2 Envelope small membrane protein[31 aa] A 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
5x29[5] B VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/91.4
9
/9
VEMP_CVHSA Envelope small membrane protein
5x29[5] E VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/91.4
6
/6
VEMP_CVHSA Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.