Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
15784 | 180 | 25 | YP_009725297.1() | |
QUERYSEQ |
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG TDPYEDFQENWNTKHSSGVTRELMRELNGG |
180 | region | name | description |
1-180 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
180 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8aou | A | 100.0 | R1AB_SARS2 Host translation inhibitor nsp1 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6zlw[12] | C | RS2_HUMAN 40S ribosomal protein S2[218 aa] | JA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 1 | |
7jqb[2] | F | uS5[221 aa] | AA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
6zlw[11] | DA | RS30_HUMAN 40S ribosomal protein S30[52 aa] | JA | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 1 | |
6zlw[11] | E | RS3_HUMAN 40S ribosomal protein S3[225 aa] | JA | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 1 | |
7jqb[2] | H | G1TNM3_RABIT Ribosomal protein S3[228 aa] | AA | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
7jqb[2] | I | G1T8A2_RABIT eS30[57 aa] | AA | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6zlw[2] | IA | 18S ribosomal RNA | JA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 1 | |
6zm7[4] | WA | 18S ribosomal RNA | HC | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 1 | |
6zmt[1] | GA | 18S ribosomal RNA | HA | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 1 | |
6zn5[1] | HA | 18S ribosomal RNA | IA | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 1 | |
6zoj[1] | A | 18S ribosomal RNA | IA | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 1 | |
6zok[1] | A | 18S ribosomal RNA | U | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 1 | |
6zon[2] | T | 18S ribosomal RNA | VA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor Nsp1 | |
7jqb[2] | A | rRNA | AA | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8a4y[1] | B |
QO6
N-(2,3-dihydro-1H-inden-5-yl)acetamide[13 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
8ays[1] | B |
92G
4-(2-amino-1,3-thiazol-4-yl)phenol[13 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
8az8[1] | B |
OEI
2-[(phenylmethyl)amino]ethanol[11 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
8crf[1] | B |
NT9
~{N}-methyl-1-(4-thiophen-2-ylphenyl)methanamine[1.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
8crk[1] | B |
OG3
(1~{R})-1-(4-chlorophenyl)ethanamine[10 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
8crm[1] | B |
OF6
1-[2-(3-chlorophenyl)-1,3-thiazol-4-yl]-~{N}-methy.. |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7k5i[1] | KA |
MG
MAGNESIUM ION[1 atoms] |
JA | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Host translation inhibitor nsp1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |