Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[100 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
595379 468 11 P08887(IL6RA_HUMAN) RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor;
QUERYSEQ
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P08887(IL6RA_HUMAN)]

468
region name description
1-19 SIGNAL
20-468 CHAIN /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895"
20-355 CHAIN /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730"
20-365 TOPO_DOM /note="Extracellular"
366-386 TRANSMEM /note="Helical"
387-468 TOPO_DOM /note="Cytoplasmic"
26-112 DOMAIN /note="Ig-like C2-type"
113-217 DOMAIN /note="Fibronectin type-III 1"
218-316 DOMAIN /note="Fibronectin type-III 2"
303-328 REGION /note="Disordered"
421-468 REGION /note="Disordered"
311-328 COMPBIAS /note="Polar residues"
1-468 DISORDER predicted by DISOPRED

MONOMER
468
pdb_id a1 identity[%]2 description
1n26 A 100.0 IL6A_HUMAN IL-6 Receptor alpha chain
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
12
/12
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 100.0
/100.0
8
/8
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m[2] B IL6_HUMAN Interleukin-6[163 aa] C 100.0
/100.0
15
/15
IL6RA_HUMAN Interleukin-6 receptor alpha chain
8d82[2] B IL6_HUMAN Interleukin-6[169 aa] A 100.0
/100.0
12
/12
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8qy5[4] B IL6_HUMAN Interleukin-6[157 aa] C 100.0
/100.0
11
/11
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8d82[2] C IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 100.0
/100.0
11
/11
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82[2] F IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 100.0
/100.0
6
/6
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8iow[2] C Light chain of Sarilumab Fab[212 aa] A 100.0
/100.0
6
/6
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8iow[1] D Heavy chain of Sarilumab Fab[207 aa] A 100.0
/100.0
12
/12
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8j6f[1] A Heavy chain of Tocilizumab Fab[211 aa] C 100.0
/100.0
14
/14
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8j6f[1] D IL6RA_HUMAN IL6R-D2 peptide[10 aa] C 100.0
/100.0
6
/6
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5[4] A IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] C 100.0
/100.0
14
/14
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
8qy5[4] F IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] C 100.0
/100.0
8
/8
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[6] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[4] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
8d82[2] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8iow[1] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
3
/3
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
1n26[2] H CYS
CYSTEINE[7 atoms]
A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[2] B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 100.0
/100.0
9
/9
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
8d82[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
1
/1
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
11
/11
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 100.0
/100.0
15
/15
IL6A_HUMAN IL-6 Receptor alpha chain
8iow[1] B IL6RA_HUMAN Interleukin-6 receptor subunit alpha[14 aa] A 100.0
/100.0
8
/8
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
468 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1n26[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.