#WARNING:no index is registered index "YP_009725300.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725300.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[100 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
19957 500 8 YP_009725300.1()
QUERYSEQ 
KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSAC
VLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYY
FMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNK
YKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725300.1()]

500
region name description
1-500 DISORDER predicted by DISOPRED

MONOMER
500
pdb_id a1 identity[%]2 description
8yb7 C 100.0 R1AB_SARS2 Non-structural protein 4 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
500 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] C 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 4
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] C 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 4
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 4
8yax[6] B R1AB_SARS2 Papain-like protease nsp3[543 aa] C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 4
8yax[6] B R1AB_SARS2 Papain-like protease nsp3[543 aa] D 100.0
/100.0		 23
/23		 R1AB_SARS2 Non-structural protein 4
8yb5[24] A R1AB_SARS2 Papain-like protease nsp3[353 aa] C 100.0
/100.0		 23
/23		 R1AB_SARS2 Non-structural protein 4
8yb5[15] A R1AB_SARS2 Papain-like protease nsp3[353 aa] C 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 4
8yb5[12] A R1AB_SARS2 Papain-like protease nsp3[353 aa] C 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 4
8yb7[3] A R1AB_SARS2 Papain-like protease nsp3[353 aa] H 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 4
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
500 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8yax[36] C R1AB_SARS2 Non-structural protein 4[371 aa] C 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 4
8yax[18] D R1AB_SARS2 Non-structural protein 4[371 aa] C 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 4
8yax[18] D R1AB_SARS2 Non-structural protein 4[371 aa] C 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 4
8yax[18] D R1AB_SARS2 Non-structural protein 4[371 aa] C 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 4
8yax[36] D R1AB_SARS2 Non-structural protein 4[371 aa] C 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 4
8yax[18] C R1AB_SARS2 Non-structural protein 4[371 aa] D 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 4
8yax[18] C R1AB_SARS2 Non-structural protein 4[371 aa] D 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 4
8yax[18] C R1AB_SARS2 Non-structural protein 4[371 aa] D 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 4
8yax[18] D R1AB_SARS2 Non-structural protein 4[371 aa] D 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 4
8yax[18] D R1AB_SARS2 Non-structural protein 4[371 aa] D 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 4
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.