Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2931865 | 365 | 14 | P04439(HLAA_HUMAN) | RecName: Full=HLA class I histocompatibility antigen, A alpha chain;AltName: Full=Human leukocyte antigen A; Short=HLA-A;Flags: Precursor; |
QUERYSEQ |
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL NEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV |
365 | region | name | description |
1-24 | SIGNAL | ||
25-365 | CHAIN | /note="HLA class I histocompatibility antigen, A alpha chain" /id="PRO_0000018815" | |
25-308 | TOPO_DOM | /note="Extracellular" | |
309-332 | TRANSMEM | /note="Helical" | |
333-365 | TOPO_DOM | /note="Cytoplasmic" | |
209-295 | DOMAIN | /note="Ig-like C1-type" | |
3-11 | REGION | /note="VL9 epitope" | |
25-114 | REGION | /note="Alpha-1" | |
115-206 | REGION | /note="Alpha-2" | |
207-298 | REGION | /note="Alpha-3" | |
299-308 | REGION | /note="Connecting peptide" | |
339-365 | REGION | /note="Disordered" | |
341-359 | COMPBIAS | /note="Polar residues" | |
31-31 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen" | |
97-97 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen" | |
108-108 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen" | |
140-140 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="2" /ligand_note="self-peptide antigen" | |
167-167 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen" | |
170-170 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen" | |
183-183 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen" | |
183-183 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="2" /ligand_note="self-peptide antigen" | |
195-195 | BINDING | /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen" | |
1-365 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
365 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7mle | A | 100.0 | HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
365 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2xpg[13] | B | B2MG_HUMAN BETA-2-MICROGLOBULIN[98 aa] | A | 100.0 /100.0 |
29 /29 |
1A03_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA .. | |
6eny[1] | A | B2MG_HUMAN Beta-2-microglobulin[99 aa] | D | 100.0 /100.0 |
3 /3 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
2xpg[1] | C | MYPR_HUMAN MYELIN PROTEOLIPID PROTEIN[9 aa] | A | 100.0 /100.0 |
26 /26 |
1A03_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA .. | |
3rl1[1] | C | Q9YV12_9HIV1 RT313 peptide[9 aa] | A | 100.0 /100.0 |
25 /25 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
3rl2[1] | C | Q9YYU8_9HIV1 Nef73 peptide from Protein Nef[10 aa] | A | 100.0 /100.0 |
24 /24 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
6eny[1] | B | TPSN_HUMAN Tapasin[364 aa] | D | 100.0 /100.0 |
11 /11 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
6eny[1] | E | CALR_HUMAN Calreticulin[365 aa] | D | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
7qpd[1] | E | CALR_HUMAN Calreticulin[364 aa] | D | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
7l1b[1] | C | PK3CA_HUMAN wild-type PIK3CA peptide[9 aa] | A | 100.0 /100.0 |
24 /24 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1c[3] | C | PK3CA_HUMAN mutant PIK3CA peptide[9 aa] | A | 100.0 /100.0 |
28 /28 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1d[1] | D | T cell receptor, alpha chain[187 aa] | A | 100.0 /100.0 |
6 /6 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1d[1] | E | T cell receptor, beta chain[247 aa] | A | 100.0 /100.0 |
12 /12 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7mle[1] | C | NCAP_INBAC Nucleoprotein peptide[9 aa] | A | 100.0 /100.0 |
25 /25 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7qpd[1] | B | TPSN_HUMAN Tapasin[348 aa] | D | 100.0 /100.0 |
26 /26 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
7qpd[1] | C | PDIA3_HUMAN Protein disulfide-isomerase A3[459 aa] | D | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
7rrg[1] | C | T cell receptor, alpha chain[185 aa] | A | 100.0 /100.0 |
10 /10 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7rrg[1] | D | T cell receptor, beta chain[237 aa] | A | 100.0 /100.0 |
6 /6 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7stf[1] | A | IgG, Fab Heavy Chain V2[216 aa] | D | 100.0 /100.0 |
16 /16 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7stf[1] | B | KRAS G12V (7-16)[10 aa] | D | 100.0 /100.0 |
19 /19 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7stf[1] | C | IgG, Fab Light Chain V2[214 aa] | D | 100.0 /100.0 |
8 /8 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7uc5[2] | C | NCAP_I46A1 Nucleoprotein peptide[9 aa] | A | 100.0 /100.0 |
30 /30 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
8dvg[1] | C | VAL-VAL-VAL-GLY-ALA-GLY-GLY-VAL-GLY-LYS[10 aa] | A | 100.0 /100.0 |
23 /23 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
365 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6eny[1] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
4 /4 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
7qpd[1] | G | alpha-D-glucopyranose-(1-3)-alpha-D-mannopyranose-.. | D | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
365 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7l1b[2] | D |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
1 /1 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1b[3] | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1c[1] | D |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1c[2] | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1c[2] | I |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
2 /2 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7rrg[1] | H |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
3 /3 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7rrg[1] | I |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7rrg[1] | R |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
1 /1 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1c[1] | F |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
4 /4 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1c[1] | G |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
3 /3 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7l1d[1] | F |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7mle[2] | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7mle[3] | E |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7mle[2] | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
7uc5[1] | I |
SO4
SULFATE ION[5 atoms] |
D | 100.0 /100.0 |
5 /5 |
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch.. | |
8dvg[1] | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | E |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | H |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | I |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | J |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | N |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | Q |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
8dvg[1] | K |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
1 /1 |
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha .. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |