Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[95 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
31918 70 0 Q7TLC7(Y14_SARS) RecName: Full=Uncharacterized protein 14;
QUERYSEQ
MLPPCYNFLKEQHCQKASTQREAEAAVKPLLAPHHVVAVIQEIQLLAAVGEILLLEWLAEVVKLPSRYCC
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q7TLC7(Y14_SARS)]

70
region name description
1-1 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.