Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
24220 | 63 | 6 | P59634(NS6_SARS) | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
QUERYSEQ |
MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP |
63 | region | name | description |
1-63 | CHAIN | /note="ORF6 protein" /id="PRO_0000106134" | |
54-63 | REGION | /note="Critical for disrupting nuclear import" |
MONOMER | |||||||
63 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7f90 | A | 100.0 | NS6_SARS ORF6 protein | ||||
7f90 | B | 100.0 | NS6_SARS ORF6 protein | ||||
7vpg | J | 100.0 | NS6_SARS ORF6 protein | ||||
7vpg | I | 100.0 | NS6_SARS ORF6 protein | ||||
7vpg | K | 100.0 | NS6_SARS ORF6 protein | ||||
7vpg | L | 100.0 | NS6_SARS ORF6 protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
63 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7f90 | C | RAE1L_HUMAN mRNA export factor[328 aa] | A | 100.0 /100.0 |
9 /9 |
NS6_SARS ORF6 protein | |
7f90 | D | RAE1L_HUMAN mRNA export factor[327 aa] | B | 100.0 /100.0 |
9 /9 |
NS6_SARS ORF6 protein | |
7vpg | A | RAE1L_HUMAN mRNA export factor[341 aa] | I | 100.0 /100.0 |
11 /11 |
NS6_SARS ORF6 protein | |
7vpg | C | RAE1L_HUMAN mRNA export factor[338 aa] | J | 100.0 /100.0 |
9 /9 |
NS6_SARS ORF6 protein | |
7vpg | E | RAE1L_HUMAN mRNA export factor[338 aa] | K | 100.0 /100.0 |
8 /8 |
NS6_SARS ORF6 protein | |
7vpg | G | RAE1L_HUMAN mRNA export factor[339 aa] | L | 100.0 /100.0 |
10 /10 |
NS6_SARS ORF6 protein | |
7vpg | F | NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu.. | K | 100.0 /100.0 |
1 /1 |
NS6_SARS ORF6 protein | |
7vpg | H | NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu.. | L | 100.0 /100.0 |
1 /1 |
NS6_SARS ORF6 protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |