Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
8514 | 75 | 30 | P0DTC4(VEMP_SARS2) | RecName: Full=Envelope small membrane protein ; Short=E; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
75 | region | name | description |
1-75 | CHAIN | /note="Envelope small membrane protein" /id="PRO_0000449651" | |
1-13 | TOPO_DOM | /note="Virion surface" ECO:0000305|PubMed:32898469" | |
14-34 | TRANSMEM | /note="Helical" ECO:0000269|PubMed:33177698, ECO:0000305|PubMed:32898469" | |
35-75 | TOPO_DOM | /note="Intravirion" ECO:0000305|PubMed:32898469" | |
61-75 | REGION | /note="Disordered" |
MONOMER | |||||||
75 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
2mm4 | A | 91.4 | VEMP_CVHSA Envelope small membrane protein | ||||
5x29 | A | 91.4 | VEMP_CVHSA Envelope small membrane protein | ||||
5x29 | D | 91.4 | VEMP_CVHSA Envelope small membrane protein | ||||
5x29 | C | 91.4 | VEMP_CVHSA Envelope small membrane protein | ||||
5x29 | B | 91.4 | VEMP_CVHSA Envelope small membrane protein | ||||
5x29 | E | 91.4 | VEMP_CVHSA Envelope small membrane protein | ||||
8suz | E | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | A | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | D | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | B | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | B | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | A | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | E | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | D | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8u1t | A | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8u1t | B | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7qcs | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7ntk | E | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7ntk | H | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7ntk | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7qcr | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7qcs | D | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7qct | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7qct | D | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7ntk | G | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7qcr | D | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7tuq | C | 66.7 | VEMP_SARS2 Envelope small membrane protein | ||||
7m4r | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
75 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7m4r | A | MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5[360 aa] | C | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein | |
7ntk | A | MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] | C | 100.0 /100.0 |
6 /6 |
VEMP_SARS2 Envelope small membrane protein | |
7ntk | D | MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] | E | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein | |
7ntk | B | MPP5_HUMAN MAGUK p55 subfamily member 5[85 aa] | G | 100.0 /100.0 |
6 /6 |
VEMP_SARS2 Envelope small membrane protein | |
7ntk | F | MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] | H | 100.0 /100.0 |
6 /6 |
VEMP_SARS2 Envelope small membrane protein | |
7qcs | A | PALS1_HUMAN Protein PALS1[97 aa] | C | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
7qcs | B | PALS1_HUMAN Protein PALS1[98 aa] | D | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
7qcr | A | AFAD_HUMAN Afadin[87 aa] | C | 100.0 /100.0 |
2 /2 |
VEMP_SARS2 Envelope small membrane protein | |
7qcr | B | AFAD_HUMAN Afadin[86 aa] | C | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein | |
7qcr | A | AFAD_HUMAN Afadin[87 aa] | D | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein | |
7qcr | B | AFAD_HUMAN Afadin[86 aa] | D | 100.0 /100.0 |
1 /1 |
VEMP_SARS2 Envelope small membrane protein | |
7qct | A | LNX2_HUMAN Ligand of Numb protein X 2[90 aa] | C | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein | |
7qct | B | LNX2_HUMAN Ligand of Numb protein X 2[90 aa] | D | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein | |
7tuq | A | BRD4_HUMAN Bromodomain-containing protein 4[124 aa] | C | 66.7 /66.7 |
3 /3 |
VEMP_SARS2 Envelope small membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
75 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7k3g | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
3 /3 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8u1t | B | VEMP_SARS2 Envelope small membrane protein[26 aa] | A | 100.0 /100.0 |
9 /9 |
VEMP_SARS2 Envelope small membrane protein | |
8u1t | A | VEMP_SARS2 Envelope small membrane protein[26 aa] | B | 100.0 /100.0 |
9 /9 |
VEMP_SARS2 Envelope small membrane protein | |
5x29 | B | VEMP_CVHSA Envelope small membrane protein[58 aa] | A | 100.0 /91.4 |
9 /9 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | E | VEMP_CVHSA Envelope small membrane protein[58 aa] | A | 100.0 /91.4 |
6 /6 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | A | VEMP_CVHSA Envelope small membrane protein[58 aa] | B | 100.0 /91.4 |
9 /9 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | C | VEMP_CVHSA Envelope small membrane protein[58 aa] | B | 100.0 /91.4 |
7 /7 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | B | VEMP_CVHSA Envelope small membrane protein[58 aa] | C | 100.0 /91.4 |
8 /8 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | D | VEMP_CVHSA Envelope small membrane protein[58 aa] | C | 100.0 /91.4 |
7 /7 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | C | VEMP_CVHSA Envelope small membrane protein[58 aa] | D | 100.0 /91.4 |
8 /8 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | E | VEMP_CVHSA Envelope small membrane protein[58 aa] | D | 100.0 /91.4 |
8 /8 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | A | VEMP_CVHSA Envelope small membrane protein[58 aa] | E | 100.0 /91.4 |
8 /8 |
VEMP_CVHSA Envelope small membrane protein | |
5x29 | D | VEMP_CVHSA Envelope small membrane protein[58 aa] | E | 100.0 /91.4 |
10 /10 |
VEMP_CVHSA Envelope small membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
75 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7ntk | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
E | 100.0 /100.0 |
1 /1 |
VEMP_SARS2 Envelope small membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |