Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
19957 | 500 | 4 | YP_009725300.1() | |
QUERYSEQ |
KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSAC VLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYY FMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNK YKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ |
500 | region | name | description |
1-500 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
500 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
3vcb | B | 61.4 | Q9J3E9_9BETC RNA-directed RNA polymerase | ||||
3vcb | A | 61.4 | Q9J3E9_9BETC RNA-directed RNA polymerase | ||||
3vc8 | B | 61.9 | Q9J3E9_9BETC RNA-directed RNA polymerase | ||||
3vc8 | A | 64.1 | Q9J3E9_9BETC RNA-directed RNA polymerase | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HOMO | |||||||
500 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3vc8 | B | Q9J3E9_9BETC RNA-directed RNA polymerase[85 aa] | A | 75.0 /64.1 |
4 /4 |
Q9J3E9_9BETC RNA-directed RNA polymerase | |
3vc8 | A | Q9J3E9_9BETC RNA-directed RNA polymerase[81 aa] | B | 75.0 /61.9 |
4 /4 |
Q9J3E9_9BETC RNA-directed RNA polymerase | |
3vcb | B | Q9J3E9_9BETC RNA-directed RNA polymerase[89 aa] | A | 60.9 /61.4 |
23 /23 |
Q9J3E9_9BETC RNA-directed RNA polymerase | |
3vcb | A | Q9J3E9_9BETC RNA-directed RNA polymerase[89 aa] | B | 59.1 /61.4 |
22 /22 |
Q9J3E9_9BETC RNA-directed RNA polymerase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |