#WARNING:no index is registered index "YP_009725297.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725297.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[50 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
13076 180 28 YP_009725297.1()
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725297.1()]

180
region name description
1-180 DISORDER predicted by DISOPRED

MONOMER
180
pdb_id a1 identity[%]2 description
8aou A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
8crm A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
8a4y A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
8a55 A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
8ays A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
7k7p A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
8crk A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
8az8 A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
8crf A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
7eq4 A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
7k3n A 100.0 R1AB_SARS2 Host translation inhibitor nsp1
2gdt A 86.1 R1AB_CVHSA Leader protein; p65 homolog; NSP1 (EC 3.4.22.-)
2hsx A 86.1 R1AB_CVHSA Leader protein; p65 homolog; NSP1 (EC 3.4.22.-)
7opl E 88.6 R1A_SARS Non-structural protein 1
7jqc AA 100.0 R1AB_SARS2 Host translation inhibitor nsp1
7jqb AA 100.0 R1AB_SARS2 Host translation inhibitor nsp1
6zlw JA 100.0 R1AB_SARS2 Non-structural protein 1
6zmo JC 100.0 R1AB_SARS2 Non-structural protein 1
6zp4 BB 100.0 R1AB_SARS2 Non-structural protein 1
6zok U 100.0 R1AB_SARS2 Non-structural protein 1
6zoj IA 100.0 R1AB_SARS2 Non-structural protein 1
6zmi HC 100.0 R1AB_SARS2 Non-structural protein 1
6zon VA 100.0 R1AB_SARS2 Host translation inhibitor Nsp1
7k5i JA 100.0 R1AB_SARS2 Host translation inhibitor nsp1
6zmt HA 100.0 R1AB_SARS2 Non-structural protein 1
6zn5 IA 100.0 R1AB_SARS2 Non-structural protein 1
6zme HC 100.0 R1AB_SARS2 Non-structural protein 1
6zm7 HC 100.0 R1AB_SARS2 Non-structural protein 1
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zoj D RS2_HUMAN 40S ribosomal protein S2[218 aa] IA 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 1
6zok D RS2_HUMAN 40S ribosomal protein S2[218 aa] U 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 1
7jqb F uS5[221 aa] AA 100.0
/100.0
8
/8
R1AB_SARS2 Host translation inhibitor nsp1
7jqc F uS5[221 aa] AA 100.0
/100.0
7
/7
R1AB_SARS2 Host translation inhibitor nsp1
7k5i S RS2_HUMAN 40S ribosomal protein S2[218 aa] JA 100.0
/100.0
7
/7
R1AB_SARS2 Host translation inhibitor nsp1
6zoj E RS3_HUMAN 40S ribosomal protein S3[225 aa] IA 100.0
/100.0
10
/10
R1AB_SARS2 Non-structural protein 1
7jqb H G1TNM3_RABIT Ribosomal protein S3[228 aa] AA 100.0
/100.0
9
/9
R1AB_SARS2 Host translation inhibitor nsp1
7jqc H G1TNM3_RABIT Ribosomal protein S3[228 aa] AA 100.0
/100.0
6
/6
R1AB_SARS2 Host translation inhibitor nsp1
7k5i D RS3_HUMAN 40S ribosomal protein S3[225 aa] JA 100.0
/100.0
8
/8
R1AB_SARS2 Host translation inhibitor nsp1
6zoj FA RS30_HUMAN 40S ribosomal protein S30[56 aa] IA 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 1
6zok T RS30_HUMAN 40S ribosomal protein S30[56 aa] U 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 1
7k5i HA RS30_HUMAN 40S ribosomal protein S30[50 aa] JA 100.0
/100.0
2
/2
R1AB_SARS2 Host translation inhibitor nsp1
7jqb I G1T8A2_RABIT eS30[57 aa] AA 100.0
/100.0
4
/4
R1AB_SARS2 Host translation inhibitor nsp1
7jqc I G1T8A2_RABIT eS30[57 aa] AA 100.0
/100.0
4
/4
R1AB_SARS2 Host translation inhibitor nsp1
7opl A DPOLA_HUMAN DNA polymerase alpha catalytic subunit[1070 aa] E 85.7
/88.6
14
/14
R1A_SARS Non-structural protein 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zoj A 18S ribosomal RNA IA 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 1
6zok A 18S ribosomal RNA U 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 1
7jqb A rRNA AA 100.0
/100.0
7
/7
R1AB_SARS2 Host translation inhibitor nsp1
7jqc A rRNA AA 100.0
/100.0
7
/7
R1AB_SARS2 Host translation inhibitor nsp1
7k5i B 40S ribosomal rRNA18S JA 100.0
/100.0
8
/8
R1AB_SARS2 Host translation inhibitor nsp1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8a4y B QO6
N-(2,3-dihydro-1H-inden-5-yl)acetamide[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Host translation inhibitor nsp1
8ays B 92G
4-(2-amino-1,3-thiazol-4-yl)phenol[13 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Host translation inhibitor nsp1
8az8 B OEI
2-[(phenylmethyl)amino]ethanol[11 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Host translation inhibitor nsp1
8crf B NT9
~{N}-methyl-1-(4-thiophen-2-ylphenyl)methanamine[1..
A 100.0
/100.0
7
/7
R1AB_SARS2 Host translation inhibitor nsp1
8crk B OG3
(1~{R})-1-(4-chlorophenyl)ethanamine[10 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Host translation inhibitor nsp1
8crm B OF6
1-[2-(3-chlorophenyl)-1,3-thiazol-4-yl]-~{N}-methy..
A 100.0
/100.0
8
/8
R1AB_SARS2 Host translation inhibitor nsp1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k5i KA MG
MAGNESIUM ION[1 atoms]
JA 100.0
/100.0
1
/1
R1AB_SARS2 Host translation inhibitor nsp1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.