Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
9866 | 346 | 174 | YP_009725310.1() | |
QUERYSEQ |
SLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKG LQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLD DFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQ |
346 | region | name | description |
1-1 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
346 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7n7r | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sbf | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n83 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7keg | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n7u | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa4 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa5 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s70 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s70 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s6x | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s6z | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n7u | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sab | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n7r | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sai | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5saa | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s6z | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n83 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n7y | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n7w | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n7w | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n7y | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7keh | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7keh | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7keg | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7kf4 | F | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7kf4 | E | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7kf4 | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7kf4 | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7kf4 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7kf4 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sbf | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sae | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sae | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sad | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sad | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sac | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sab | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sai | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sah | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sah | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sag | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sag | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5saf | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sac | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5saf | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa6 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa5 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa4 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s72 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s71 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s71 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5saa | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa9 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa8 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa8 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa7 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa7 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s72 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa6 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s6y | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s6y | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5s6x | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
5sa9 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6vww | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6x4i | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6vww | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6wlc | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6x1b | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6wxc | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6wlc | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k9p | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6xdh | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6x1b | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7me0 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb2 | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7me0 | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7me0 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb0 | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb0 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb2 | F | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb2 | E | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb2 | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb0 | F | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb0 | E | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb0 | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7me0 | F | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7me0 | E | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7me0 | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb0 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb2 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7rb2 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n06 | E | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n06 | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n06 | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n06 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n06 | F | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k1o | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n06 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6w01 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6xdh | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k1o | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k1l | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k1l | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k1o | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k9p | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6wxc | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6w01 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
6x4i | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
8d34 | A | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
8ud5 | F | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud5 | E | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud5 | D | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud5 | C | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud5 | B | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud5 | A | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud4 | F | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud4 | E | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud4 | D | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud4 | C | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud4 | B | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud4 | A | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud3 | F | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud3 | E | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud3 | D | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud3 | C | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud3 | B | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud3 | A | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud2 | F | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud2 | E | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud2 | D | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud2 | C | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud2 | B | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8ud2 | A | 99.7 | R1AB_SARS2 Non-structural protein 15 | ||||
8d34 | B | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
7n33 | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k0r | F | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k0r | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k0r | E | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k0r | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k0r | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7k0r | A | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n33 | F | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n33 | E | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n33 | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n33 | C | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7n33 | B | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
8u2x | A | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
7tj2 | A | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
7tqv | A | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7tj2 | B | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
7tj2 | C | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
7tj2 | F | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
7tqv | E | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7tqv | C | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7tj2 | E | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
7tqv | F | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7tqv | D | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
7tqv | B | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease | ||||
2rhb | E | 88.4 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2rhb | D | 88.4 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2rhb | B | 88.4 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2rhb | F | 88.4 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2rhb | C | 88.4 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2rhb | A | 88.4 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2h85 | A | 88.1 | Q6VA80_CVHSA Putative orf1ab polyprotein | ||||
8u2x | B | 99.7 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
2ozk | A | 88.6 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2ozk | B | 88.5 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2ozk | D | 88.5 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
2ozk | C | 88.3 | R1AB_CVHSA Uridylate-specific endoribonuclease | ||||
7tj2 | D | 100.0 | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | ||||
5yvd | A | 51.9 | A0A0U2GPI9_9BETC Nsp15 | ||||
5yvd | B | 51.9 | A0A0U2GPI9_9BETC Nsp15 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
NUCLEOTIDE | |||||||
346 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6x1b | C | DNA (5'-R(*GP*U)-3') | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | C | DNA (5'-R(*GP*U)-3') | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | C | DNA (5'-R(*GP*U)-3') | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | D | DNA (5'-R(*GP*U)-3') | B | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | D | DNA (5'-R(*GP*U)-3') | B | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | D | DNA (5'-R(*GP*U)-3') | B | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | G | RNA (5'-R(*AP*UP*A)-3') | A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | H | RNA (5'-R(*AP*UP*A)-3') | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | H | RNA (5'-R(*AP*UP*A)-3') | B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | I | RNA (5'-R(*AP*UP*A)-3') | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | G | RNA (5'-R(*AP*UP*A)-3') | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | I | RNA (5'-R(*AP*UP*A)-3') | C | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | J | RNA (5'-R(*AP*UP*A)-3') | D | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | K | RNA (5'-R(*AP*UP*A)-3') | E | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | L | RNA (5'-R(*AP*UP*A)-3') | F | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | G | RNA (5'-R(*A)-D(*(UFT))-R(P*A)-3') | A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | H | RNA (5'-R(*A)-D(*(UFT))-R(P*A)-3') | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | I | RNA (5'-R(*A)-D(*(UFT))-R(P*A)-3') | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | J | RNA (5'-R(*A)-D(*(UFT))-R(P*A)-3') | D | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | K | RNA (5'-R(*A)-D(*(UFT))-R(P*A)-3') | E | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | L | RNA (5'-R(*A)-D(*(UFT))-R(P*A)-3') | F | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
8ud3 | G | RNA (35-MER) | D | 100.0 /99.7 |
5 /5 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | G | RNA (35-MER) | E | 100.0 /99.7 |
12 /12 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | H | RNA (35-MER) | D | 100.0 /99.7 |
1 /1 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | H | RNA (35-MER) | E | 100.0 /99.7 |
7 /7 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | G | RNA (35-MER) | D | 100.0 /99.7 |
5 /5 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | G | RNA (35-MER) | E | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | H | RNA (35-MER) | D | 100.0 /99.7 |
1 /1 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | H | RNA (35-MER) | E | 100.0 /99.7 |
8 /8 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | G | RNA (35-MER) | B | 100.0 /99.7 |
6 /6 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | G | RNA (35-MER) | D | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | G | RNA (35-MER) | E | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | H | RNA (35-MER) | B | 100.0 /99.7 |
3 /3 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | H | RNA (35-MER) | D | 100.0 /99.7 |
1 /1 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | H | RNA (35-MER) | E | 100.0 /99.7 |
7 /7 |
R1AB_SARS2 Non-structural protein 15 | |
7tj2 | G | RNA (31-MER) | A | 100.0 /99.7 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | G | RNA (31-MER) | C | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | G | RNA (31-MER) | E | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | H | RNA (31-MER) | A | 100.0 /99.7 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | H | RNA (31-MER) | C | 100.0 /99.7 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | H | RNA (31-MER) | E | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tqv | G | RNA (33-MER) | A | 100.0 /99.7 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | G | RNA (33-MER) | C | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | G | RNA (33-MER) | E | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | H | RNA (33-MER) | A | 100.0 /99.7 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | H | RNA (33-MER) | C | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | H | RNA (33-MER) | E | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
346 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5s6x | D |
WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | D |
WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | D |
WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | F |
WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | F |
WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | F |
WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | D |
WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | D |
WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | D |
WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | F |
WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | F |
WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | F |
WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | D |
WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | D |
WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | D |
WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | F |
WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | F |
WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | F |
WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | E |
WUS
(5R)-2-methyl-4,5,6,7-tetrahydro-1H-benzimidazol-5.. |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | E |
WUS
(5R)-2-methyl-4,5,6,7-tetrahydro-1H-benzimidazol-5.. |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | E |
WUS
(5R)-2-methyl-4,5,6,7-tetrahydro-1H-benzimidazol-5.. |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | D |
WUV
5'-thiothymidine[17 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | D |
WUV
5'-thiothymidine[17 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | D |
WUV
5'-thiothymidine[17 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | D |
WUV
5'-thiothymidine[17 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | D |
WUV
5'-thiothymidine[17 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | D |
WUV
5'-thiothymidine[17 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | F |
WUV
5'-thiothymidine[17 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | F |
WUV
5'-thiothymidine[17 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | F |
WUV
5'-thiothymidine[17 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | F |
WUV
5'-thiothymidine[17 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | F |
WUV
5'-thiothymidine[17 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | F |
WUV
5'-thiothymidine[17 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | D |
WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | D |
WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | D |
WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | D |
WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | D |
WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | D |
WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | C |
K3A
N-(5-methyl-1H-pyrazol-3-yl)acetamide[10 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | C |
K3A
N-(5-methyl-1H-pyrazol-3-yl)acetamide[10 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | C |
K3A
N-(5-methyl-1H-pyrazol-3-yl)acetamide[10 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | E |
ZQA
4-ethyl-2-(1H-imidazol-5-yl)-1,3-thiazole[12 atoms.. |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | E |
ZQA
4-ethyl-2-(1H-imidazol-5-yl)-1,3-thiazole[12 atoms.. |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | E |
ZQA
4-ethyl-2-(1H-imidazol-5-yl)-1,3-thiazole[12 atoms.. |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | C |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | C |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | C |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | C |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | C |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | C |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | D |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | D |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | D |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | D |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | D |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | D |
O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | C |
WL7
4-amino-N-(2-hydroxyethyl)-N-methylbenzene-1-sulfo.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | C |
WL7
4-amino-N-(2-hydroxyethyl)-N-methylbenzene-1-sulfo.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | C |
WL7
4-amino-N-(2-hydroxyethyl)-N-methylbenzene-1-sulfo.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | C |
WL7
4-amino-N-(2-hydroxyethyl)-N-methylbenzene-1-sulfo.. |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | C |
WL7
4-amino-N-(2-hydroxyethyl)-N-methylbenzene-1-sulfo.. |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | C |
WL7
4-amino-N-(2-hydroxyethyl)-N-methylbenzene-1-sulfo.. |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | C |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | C |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | C |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | C |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | C |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | C |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | D |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | D |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | D |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | D |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | D |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | D |
JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | C |
GWG
1-methylindazole-3-carboxamide[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | C |
GWG
1-methylindazole-3-carboxamide[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | C |
GWG
1-methylindazole-3-carboxamide[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | D |
ZQD
3-[(2S)-1-(methanesulfonyl)pyrrolidin-2-yl]-5-meth.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | D |
ZQD
3-[(2S)-1-(methanesulfonyl)pyrrolidin-2-yl]-5-meth.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | D |
ZQD
3-[(2S)-1-(methanesulfonyl)pyrrolidin-2-yl]-5-meth.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | F |
ZQD
3-[(2S)-1-(methanesulfonyl)pyrrolidin-2-yl]-5-meth.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | F |
ZQD
3-[(2S)-1-(methanesulfonyl)pyrrolidin-2-yl]-5-meth.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | F |
ZQD
3-[(2S)-1-(methanesulfonyl)pyrrolidin-2-yl]-5-meth.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | E |
WJD
2-methoxy-N-phenylacetamide[12 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | E |
WJD
2-methoxy-N-phenylacetamide[12 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | E |
WJD
2-methoxy-N-phenylacetamide[12 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | E |
VWG
N-hydroxyquinoline-2-carboxamide[14 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | E |
VWG
N-hydroxyquinoline-2-carboxamide[14 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | E |
VWG
N-hydroxyquinoline-2-carboxamide[14 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | C |
EJW
(3-phenyl-1,2-oxazol-5-yl)methylazanium[13 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | C |
EJW
(3-phenyl-1,2-oxazol-5-yl)methylazanium[13 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | C |
EJW
(3-phenyl-1,2-oxazol-5-yl)methylazanium[13 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | D |
W3G
pyridazin-3(2H)-one[7 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | D |
W3G
pyridazin-3(2H)-one[7 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | D |
W3G
pyridazin-3(2H)-one[7 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | F |
W3G
pyridazin-3(2H)-one[7 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | F |
W3G
pyridazin-3(2H)-one[7 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | F |
W3G
pyridazin-3(2H)-one[7 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | D |
WOY
6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine[9 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | D |
WOY
6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine[9 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | D |
WOY
6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine[9 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | E |
WOY
6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine[9 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | E |
WOY
6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine[9 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | E |
WOY
6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine[9 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | C |
ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | C |
ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | C |
ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | C |
ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | C |
ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | C |
ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | C |
ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | C |
ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | C |
ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | D |
ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | D |
ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | D |
ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | C |
ZQM
N-{2-[(propan-2-yl)sulfanyl]phenyl}urea[14 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | C |
ZQM
N-{2-[(propan-2-yl)sulfanyl]phenyl}urea[14 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | C |
ZQM
N-{2-[(propan-2-yl)sulfanyl]phenyl}urea[14 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | C |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | C |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | C |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | M |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | M |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | M |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | G |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | I |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | K |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | M |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | O |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
E | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | Q |
U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] |
F | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | C |
CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL.. |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | C |
CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL.. |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | C |
CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL.. |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | M |
CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | M |
CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | M |
CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL.. |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | C |
U3P
3'-URIDINEMONOPHOSPHATE[21 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | C |
U3P
3'-URIDINEMONOPHOSPHATE[21 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | C |
U3P
3'-URIDINEMONOPHOSPHATE[21 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | O |
U3P
3'-URIDINEMONOPHOSPHATE[21 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | O |
U3P
3'-URIDINEMONOPHOSPHATE[21 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | O |
U3P
3'-URIDINEMONOPHOSPHATE[21 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | C |
UVC
URIDINE-2',3'-VANADATE[21 atoms] |
A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | C |
UVC
URIDINE-2',3'-VANADATE[21 atoms] |
A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | C |
UVC
URIDINE-2',3'-VANADATE[21 atoms] |
A | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | H |
UVC
URIDINE-2',3'-VANADATE[21 atoms] |
B | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | H |
UVC
URIDINE-2',3'-VANADATE[21 atoms] |
B | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | H |
UVC
URIDINE-2',3'-VANADATE[21 atoms] |
B | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | D |
VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | D |
VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | F |
VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi.. |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | F |
VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi.. |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | H |
VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi.. |
C | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | H |
VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi.. |
C | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | C |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | C |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | C |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | E |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | E |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | E |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | E |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | E |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | E |
B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | C |
S6V
1-[2-(2-oxidanylidenepyrrolidin-1-yl)ethyl]-3-phen.. |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | C |
S6V
1-[2-(2-oxidanylidenepyrrolidin-1-yl)ethyl]-3-phen.. |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | C |
S6V
1-[2-(2-oxidanylidenepyrrolidin-1-yl)ethyl]-3-phen.. |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | C |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | C |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | C |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | C |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | C |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | C |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | D |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | D |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | D |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | D |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | D |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | D |
0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | C |
0OI
N-(2-fluorophenyl)-N'-methylurea[12 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | C |
0OI
N-(2-fluorophenyl)-N'-methylurea[12 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | C |
0OI
N-(2-fluorophenyl)-N'-methylurea[12 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | C |
RZG
methyl 4-sulfamoylbenzoate[14 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | C |
RZG
methyl 4-sulfamoylbenzoate[14 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | C |
RZG
methyl 4-sulfamoylbenzoate[14 atoms] |
A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | D |
RZG
methyl 4-sulfamoylbenzoate[14 atoms] |
B | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | D |
RZG
methyl 4-sulfamoylbenzoate[14 atoms] |
B | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | D |
RZG
methyl 4-sulfamoylbenzoate[14 atoms] |
B | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | D |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | D |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | D |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | D |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | D |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | D |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | E |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | E |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | E |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | E |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | E |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | E |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | F |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | F |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | F |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | G |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | G |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | G |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | I |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | I |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | I |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | I |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | I |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | I |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | J |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | J |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | J |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | K |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | K |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | K |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | K |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | K |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | K |
WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
346 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6vww | E |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | E |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | E |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | P |
NA
SODIUM ION[1 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | P |
NA
SODIUM ION[1 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | P |
NA
SODIUM ION[1 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | L |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | L |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | L |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
8u2x | D |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /99.7 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | D |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /99.7 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | D |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /99.7 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | E |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | E |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | E |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
346 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa6 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa7 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa8 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa9 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sad | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sag | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sah | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sai | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | A | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
17 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
17 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
17 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
17 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | C | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | A | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | D | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | A | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | F | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | B | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | C | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | E | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | F | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | C | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | E | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | C | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | E | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | D | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | F | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | D | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | C | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | E | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | D | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | E | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | F | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | E | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | F | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | D | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | F | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | E | R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] | F | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
17 /19 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
17 /19 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
17 /19 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
17 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
17 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | C | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | C | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | C | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | C | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
12 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
12 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
12 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | B | R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
30 /30 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | C | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | C | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | D | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | D | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | D | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | E | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | E | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | E | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | F | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | F | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | F | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
13 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
15 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7me0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
16 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n06 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | A | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | C | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | C | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | D | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | D | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | D | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | E | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | E | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | E | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | F | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | F | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n33 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] | F | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7r | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
15 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7u | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
16 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7w | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n7y | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | A | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
14 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /100.0 |
29 /29 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb0 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /100.0 |
11 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
10 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
11 /12 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
9 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
9 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | A | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
10 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7rb2 | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tj2 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | C | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | C | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | B | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | F | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | B | 100.0 /99.7 |
11 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | C | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | C | 100.0 /99.7 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | E | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | C | 100.0 /99.7 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | D | 100.0 /100.0 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | E | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | F | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | C | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | E | 100.0 /99.7 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | F | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | E | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | F | 100.0 /99.7 |
11 /13 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | E | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | F | 100.0 /99.7 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tqv | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /99.7 |
21 /21 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /99.7 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | A | 100.0 /99.7 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | B | 100.0 /99.7 |
17 /17 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /99.7 |
24 /24 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | B | 100.0 /99.7 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | C | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /99.7 |
21 /21 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | C | 100.0 /99.7 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | A | R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] | D | 100.0 /99.7 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /99.7 |
18 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | D | 100.0 /99.7 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | C | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /99.7 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | F | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | E | 100.0 /99.7 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | B | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /99.7 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | D | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7tqv | E | R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] | F | 100.0 /99.7 |
23 /23 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
22 /22 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | A | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
14 /16 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
13 /15 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
18 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
18 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
18 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
18 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
18 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8d34 | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] | B | 100.0 /99.7 |
18 /18 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | A | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[347 aa] | A | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8ud2 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud2 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud3 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
28 /28 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
24 /24 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
13 /13 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
24 /24 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
13 /13 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
23 /23 |
R1AB_SARS2 Non-structural protein 15 | |
8ud4 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | A | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | B | 100.0 /99.7 |
14 /14 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | C | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | B | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
13 /13 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | D | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | A | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
13 /13 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | F | R1AB_SARS2 Non-structural protein 15[346 aa] | E | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | C | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
15 /15 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | D | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
26 /26 |
R1AB_SARS2 Non-structural protein 15 | |
8ud5 | E | R1AB_SARS2 Non-structural protein 15[346 aa] | F | 100.0 /99.7 |
27 /27 |
R1AB_SARS2 Non-structural protein 15 | |
7tj2 | D | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[271 aa] | A | 100.0 /99.7 |
12 /14 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | D | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[271 aa] | E | 100.0 /99.7 |
21 /21 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
7tj2 | D | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[271 aa] | F | 100.0 /99.7 |
25 /25 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[310 aa] | B | 100.0 /99.7 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[310 aa] | B | 100.0 /99.7 |
19 /19 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[310 aa] | B | 100.0 /99.7 |
19 /19 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[310 aa] | B | 100.0 /99.7 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[310 aa] | B | 100.0 /99.7 |
20 /20 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | B | R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[310 aa] | B | 100.0 /99.7 |
19 /19 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.7 /88.1 |
28 /28 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.2 /88.1 |
27 /27 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 92.9 /88.1 |
14 /16 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.2 /88.1 |
27 /27 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.7 /88.1 |
28 /28 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 92.9 /88.1 |
14 /16 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.7 /88.1 |
28 /28 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.2 /88.1 |
27 /27 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 92.9 /88.1 |
14 /16 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 92.9 /88.1 |
14 /16 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.7 /88.1 |
28 /28 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.2 /88.1 |
27 /27 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 92.9 /88.1 |
14 /16 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.2 /88.1 |
27 /27 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.7 /88.1 |
28 /28 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 92.9 /88.1 |
14 /16 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.7 /88.1 |
28 /28 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2h85 | A | Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] | A | 85.2 /88.1 |
27 /27 |
Q6VA80_CVHSA Putative orf1ab polyprotein | |
2ozk | B | R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] | A | 86.7 /88.6 |
30 /30 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | C | R1AB_CVHSA Uridylate-specific endoribonuclease[291 aa] | A | 81.8 /88.6 |
11 /11 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | D | R1AB_CVHSA Uridylate-specific endoribonuclease[296 aa] | A | 66.7 /88.6 |
3 /3 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | A | R1AB_CVHSA Uridylate-specific endoribonuclease[306 aa] | B | 87.1 /88.5 |
31 /31 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | C | R1AB_CVHSA Uridylate-specific endoribonuclease[291 aa] | B | 66.7 /88.5 |
3 /3 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | D | R1AB_CVHSA Uridylate-specific endoribonuclease[296 aa] | B | 84.6 /88.5 |
13 /13 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | A | R1AB_CVHSA Uridylate-specific endoribonuclease[306 aa] | C | 85.7 /88.3 |
14 /14 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | B | R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] | C | 100.0 /88.3 |
3 /3 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | A | R1AB_CVHSA Uridylate-specific endoribonuclease[306 aa] | D | 100.0 /88.5 |
3 /3 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2ozk | B | R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] | D | 90.0 /88.5 |
20 /20 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | B | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | A | 88.0 /88.4 |
25 /25 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | C | R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] | A | 85.2 /88.4 |
27 /27 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | E | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | A | 93.8 /88.4 |
16 /17 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | A | R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] | B | 86.2 /88.4 |
29 /29 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | C | R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] | B | 88.0 /88.4 |
25 /25 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | D | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | B | 92.9 /88.4 |
14 /16 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | A | R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] | C | 88.5 /88.4 |
26 /26 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | B | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | C | 85.7 /88.4 |
28 /28 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | F | R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] | C | 100.0 /88.4 |
12 /13 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | B | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | D | 100.0 /88.4 |
13 /15 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | E | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | D | 88.0 /88.4 |
25 /25 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | F | R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] | D | 86.7 /88.4 |
30 /30 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | A | R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] | E | 100.0 /88.4 |
13 /15 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | D | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | E | 85.2 /88.4 |
27 /27 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | F | R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] | E | 88.0 /88.4 |
25 /25 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | C | R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] | F | 92.9 /88.4 |
14 /14 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | D | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | F | 88.5 /88.4 |
26 /26 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
2rhb | E | R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] | F | 86.2 /88.4 |
29 /29 |
R1AB_CVHSA Uridylate-specific endoribonuclease | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 41.4 /51.9 |
29 /29 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 40.0 /51.9 |
25 /25 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 40.0 /51.9 |
25 /25 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 41.4 /51.9 |
29 /29 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 41.4 /51.9 |
29 /29 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 40.0 /51.9 |
25 /25 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 61.5 /51.9 |
13 /14 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 25.0 /51.9 |
4 /4 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 100.0 /51.9 |
1 /1 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 100.0 /51.9 |
1 /1 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 61.5 /51.9 |
13 /14 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 25.0 /51.9 |
4 /4 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 25.0 /51.9 |
4 /4 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 100.0 /51.9 |
1 /1 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | A | 61.5 /51.9 |
13 /14 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 60.0 /51.9 |
15 /16 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 100.0 /51.9 |
1 /1 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 33.3 /51.9 |
3 /3 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 33.3 /51.9 |
3 /3 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 60.0 /51.9 |
15 /16 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 100.0 /51.9 |
1 /1 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 100.0 /51.9 |
1 /1 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 33.3 /51.9 |
3 /3 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | A | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 60.0 /51.9 |
15 /16 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 46.2 /51.9 |
26 /26 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 44.8 /51.9 |
29 /29 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 44.8 /51.9 |
29 /29 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 46.2 /51.9 |
26 /26 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 46.2 /51.9 |
26 /26 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | B | A0A0U2GPI9_9BETC Nsp15[341 aa] | B | 44.8 /51.9 |
29 /29 |
A0A0U2GPI9_9BETC Nsp15 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
346 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5s6x | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6x | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6y | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s6z | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s70 | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s71 | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5s72 | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sa5 | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saa | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sab | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sac | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sae | E |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | F |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | F |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5saf | F |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5sbf | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | N |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | N |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | N |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | X |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | X |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | X |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | D |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | D |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | D |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | J |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | J |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | J |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k9p | D |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | G |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | H |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | I |
CIT
CITRIC ACID[13 atoms] |
C | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | J |
CIT
CITRIC ACID[13 atoms] |
D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | K |
CIT
CITRIC ACID[13 atoms] |
E | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7kf4 | L |
CIT
CITRIC ACID[13 atoms] |
F | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | C |
CIT
CITRIC ACID[13 atoms] |
A | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | H |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | H |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7n83 | H |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
5yvd | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /51.9 |
6 /6 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /51.9 |
6 /6 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /51.9 |
6 /6 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | D |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /51.9 |
7 /7 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | D |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /51.9 |
7 /7 |
A0A0U2GPI9_9BETC Nsp15 | |
5yvd | D |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /51.9 |
7 /7 |
A0A0U2GPI9_9BETC Nsp15 | |
6vww | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | C |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | D |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | D |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | D |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | F |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | F |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | F |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | G |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | G |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | G |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | I |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | I |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | I |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | J |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | J |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | J |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | K |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | K |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | K |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | M |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | M |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | M |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | N |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | N |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | N |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | H |
ACY
ACETIC ACID[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | H |
ACY
ACETIC ACID[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | H |
ACY
ACETIC ACID[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | O |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | O |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | O |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | P |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | P |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6vww | P |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | C |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | C |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | C |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | BA |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | BA |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | BA |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | CA |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | CA |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | CA |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | V |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | V |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | V |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Y |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Y |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Y |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Z |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Z |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | Z |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | N |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | N |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | N |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | V |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | V |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | V |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | X |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | X |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | X |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | Y |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | Y |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x4i | Y |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1o | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | G |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | G |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | G |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | H |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | H |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | H |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | AA |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | AA |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6w01 | AA |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | F |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | F |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | F |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | Q |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | Q |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | Q |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | S |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | S |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | S |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | T |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | T |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | T |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | C |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | C |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | C |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | C |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | C |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | C |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | H |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | H |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | H |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | H |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | H |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | H |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | K |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | K |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | K |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | E |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | E |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | E |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | L |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | L |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | L |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | I |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | I |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k1l | I |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | D |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | F |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | F |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keh | F |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | U |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | U |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | U |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | U |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | U |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | U |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | V |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | V |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | V |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | K |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | K |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | K |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | K |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | K |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | K |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | P |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | P |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | P |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | Q |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | Q |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | Q |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | R |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | R |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | R |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | E |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | E |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | E |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | F |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | F |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | F |
FMT
FORMIC ACID[3 atoms] |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | G |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | G |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | G |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | I |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | I |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | I |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | M |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | M |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6xdh | M |
FMT
FORMIC ACID[3 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | D |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | D |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | D |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | N |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | N |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wxc | N |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | E |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | E |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | E |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | I |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | I |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6x1b | I |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | H |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | J |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | L |
PO4
PHOSPHATE ION[5 atoms] |
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | N |
PO4
PHOSPHATE ION[5 atoms] |
D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | P |
PO4
PHOSPHATE ION[5 atoms] |
E | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7k0r | R |
PO4
PHOSPHATE ION[5 atoms] |
F | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | C |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | C |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | C |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | D |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | D |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
7keg | D |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | D |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | D |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | D |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | N |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | N |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | N |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | N |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | N |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
6wlc | N |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease | |
8u2x | C |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
A | 100.0 /99.7 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | C |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
A | 100.0 /99.7 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | C |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
A | 100.0 /99.7 |
3 /3 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | F |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | F |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
8u2x | F |
TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] |
B | 100.0 /99.7 |
4 /4 |
R1AB_SARS2 Uridylate-specific endoribonuclease nsp15 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |