Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
20796 | 198 | 148 | YP_009725304.1() | |
QUERYSEQ |
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
198 | region | name | description |
1-198 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
198 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8gwe | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uo9 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uoe | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwm | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwb | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uo4 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7eiz | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7egq | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwk | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwf | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gw1 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8sqj | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uo4 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwo | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8sqk | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7egq | J | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwf | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwe | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwi | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwn | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwi | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwg | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwg | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uob | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7cyq | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7cxn | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7cxm | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dte | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
2ahm | H | 97.4 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | ||||
2ahm | G | 97.4 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | ||||
8gwk | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwm | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7egq | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8sq9 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwb | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7eiz | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8sq9 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7egq | L | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwn | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gw1 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gwo | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uo9 | F | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uob | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uoe | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uo7 | F | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7uo7 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7cyq | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7cxn | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7cxm | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6xez | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7krp | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re3 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7rdz | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7krn | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6xez | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re1 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re2 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re0 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re3 | G | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7rdy | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7rdx | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7kro | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dte | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6yyt | B | 100.0 | R1AB_SARS2 nsp8 | ||||
6yyt | D | 100.0 | R1AB_SARS2 nsp8 | ||||
8sqk | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8sqj | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7kro | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7krp | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re2 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re1 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re0 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re3 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7re3 | L | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7rdy | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7rdz | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7rdx | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7krn | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dok | F | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dok | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7ed5 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
2ahm | E | 97.4 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | ||||
7ed5 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
2ahm | F | 97.2 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | ||||
7c2k | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7btf | C | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6wqd | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6yhu | B | 100.0 | R1A_SARS2 Replicase polyprotein 1a | ||||
6xip | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dcd | D | 100.0 | R1A_SARS2 Non-structural protein 8 | ||||
7dcd | B | 100.0 | R1A_SARS2 Non-structural protein 8 | ||||
6yhu | D | 100.0 | R1A_SARS2 Replicase polyprotein 1a | ||||
6wtc | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dfg | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6wtc | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7jlt | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7c2k | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6wiq | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6xip | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7jlt | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dcd | H | 100.0 | R1A_SARS2 Non-structural protein 8 | ||||
7l1f | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6wqd | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6m5i | A | 100.0 | R1A_SARS2 Non-structural protein 8 | ||||
7b3b | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7b3c | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7b3d | B | 100.0 | R1AB_SARS2 SARS-CoV-2 nsp8 | ||||
7bw4 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7ozu | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7ozv | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dcd | F | 100.0 | R1A_SARS2 Non-structural protein 8 | ||||
7aap | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7ctt | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dfh | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7doi | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7d4f | A | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7bzf | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6xqb | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7bv2 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7bv1 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
5f22 | B | 96.5 | R1AB_CVHSA Non-structural protein | ||||
8gy6 | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6m71 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6nur | B | 96.5 | R1A_CVHSA NSP8 | ||||
6nus | B | 96.4 | R1A_CVHSA NSP8 | ||||
7thm | B | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dfg | F | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7dfh | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7doi | F | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7d4f | C | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6nur | D | 96.3 | R1A_CVHSA NSP8 | ||||
7bzf | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7btf | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7bv1 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8urb | B | 44.0 | U6BRU0_9ALPC nsp8 | ||||
7bw4 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7oyg | G | 100.0 | R1AB_SARS2 SARS-CoV-2 nsp8 | ||||
7oyg | B | 100.0 | R1AB_SARS2 SARS-CoV-2 nsp8 | ||||
8urb | D | 43.3 | U6BRU0_9ALPC nsp8 | ||||
7ywr | A | 100.0 | A0A8A0A7W8_SARS2 ORF1a polyprotein | ||||
3ub0 | D | 43.2 | R1AB_FIPV Non-structural protein 6, nsp6, | ||||
3ub0 | A | 42.7 | R1AB_FIPV Non-structural protein 6, nsp6, | ||||
7thm | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
8gy6 | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6m71 | C | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
6xqb | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7aap | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
7ctt | D | 100.0 | R1AB_SARS2 Non-structural protein 8 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
198 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | E | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | E | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | G | 100.0 /97.4 |
22 /22 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | G | 100.0 /97.4 |
22 /22 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | G | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | G | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | H | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | H | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | H | 100.0 /97.4 |
25 /25 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | H | 100.0 /97.4 |
25 /25 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
5f22 | A | R1A_CVHSA Non-structural protein 7[79 aa] | B | 100.0 /96.5 |
25 /25 |
R1AB_CVHSA Non-structural protein | |
6m5i | B | R1A_SARS2 Non-structural protein 7[81 aa] | A | 100.0 /100.0 |
24 /24 |
R1A_SARS2 Non-structural protein 8 | |
6m71 | B | R1AB_SARS2 Non-structural protein 7[70 aa] | C | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 | |
6m71 | B | R1AB_SARS2 Non-structural protein 7[70 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
6nur | C | R1AB_CVHSA NSP7[70 aa] | B | 100.0 /96.5 |
5 /5 |
R1A_CVHSA NSP8 | |
6nur | C | R1AB_CVHSA NSP7[70 aa] | D | 100.0 /96.3 |
24 /24 |
R1A_CVHSA NSP8 | |
6wiq | A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
6wiq | A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
6wiq | A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
6wiq | A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
6wqd | A | R1AB_SARS2 Non-structural protein 7[74 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
6wqd | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
6wqd | A | R1AB_SARS2 Non-structural protein 7[74 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
6wqd | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
6wtc | A | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
6wtc | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
6wtc | A | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
6wtc | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | A | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | A | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
6xqb | C | R1AB_SARS2 Non-structural protein 7[62 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
6yhu | A | R1A_SARS2 Replicase polyprotein 1a[71 aa] | B | 100.0 /100.0 |
26 /26 |
R1A_SARS2 Replicase polyprotein 1a | |
6yhu | C | R1A_SARS2 Replicase polyprotein 1a[71 aa] | D | 100.0 /100.0 |
25 /25 |
R1A_SARS2 Replicase polyprotein 1a | |
6yyt | C | R1AB_SARS2 nsp7[73 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 nsp8 | |
6yyt | C | R1AB_SARS2 nsp7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 nsp8 | |
7aap | C | R1AB_SARS2 Non-structural protein 7[67 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7aap | C | R1AB_SARS2 Non-structural protein 7[67 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7b3b | C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7b3c | C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7b3d | C | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 SARS-CoV-2 nsp8 | |
7btf | B | R1AB_SARS2 Non-structural protein 7[68 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7btf | B | R1AB_SARS2 Non-structural protein 7[68 aa] | D | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 | |
7bv1 | C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7bv1 | C | R1AB_SARS2 Non-structural protein 7[63 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 | |
7bv2 | C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7bw4 | C | R1AB_SARS2 Non-structural protein 7[65 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7bw4 | C | R1AB_SARS2 Non-structural protein 7[65 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 | |
7bzf | C | R1AB_SARS2 Non-structural protein 7[68 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7bzf | C | R1AB_SARS2 Non-structural protein 7[68 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 | |
7c2k | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7c2k | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
7ctt | C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7ctt | C | R1AB_SARS2 Non-structural protein 7[63 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 8 | |
7d4f | B | R1AB_SARS2 Non-structural protein 7[63 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7d4f | B | R1AB_SARS2 Non-structural protein 7[63 aa] | C | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 | |
7dcd | A | R1A_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
26 /26 |
R1A_SARS2 Non-structural protein 8 | |
7dcd | C | R1A_SARS2 Non-structural protein 7[76 aa] | D | 100.0 /100.0 |
22 /22 |
R1A_SARS2 Non-structural protein 8 | |
7dcd | E | R1A_SARS2 Non-structural protein 7[76 aa] | F | 100.0 /100.0 |
21 /21 |
R1A_SARS2 Non-structural protein 8 | |
7dcd | G | R1A_SARS2 Non-structural protein 7[75 aa] | H | 100.0 /100.0 |
23 /23 |
R1A_SARS2 Non-structural protein 8 | |
7dfg | E | R1AB_SARS2 Non-structural protein 7[69 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7dfg | E | R1AB_SARS2 Non-structural protein 7[69 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7dfh | C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7dfh | C | R1AB_SARS2 Non-structural protein 7[63 aa] | D | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 8 | |
7doi | C | R1AB_SARS2 Non-structural protein 7[69 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7doi | C | R1AB_SARS2 Non-structural protein 7[69 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7dok | E | R1AB_SARS2 Non-structural protein 7[69 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7dok | E | R1AB_SARS2 Non-structural protein 7[69 aa] | F | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | K | R1AB_SARS2 Non-structural protein 7[72 aa] | J | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | K | R1AB_SARS2 Non-structural protein 7[72 aa] | L | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 | |
7jlt | A | R1AB_SARS2 Non-structural protein 7[79 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
7jlt | C | R1AB_SARS2 Non-structural protein 7[81 aa] | B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
7jlt | A | R1AB_SARS2 Non-structural protein 7[79 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7jlt | C | R1AB_SARS2 Non-structural protein 7[81 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 | |
7l1f | C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7oyg | C | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 SARS-CoV-2 nsp8 | |
7oyg | H | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 SARS-CoV-2 nsp8 | |
7ozu | C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7ozv | C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | K | R1AB_SARS2 Non-structural protein 7[75 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | K | R1AB_SARS2 Non-structural protein 7[75 aa] | L | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | F | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | C | R1A_SARS2 Replicase polyprotein 1a[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | C | R1A_SARS2 Replicase polyprotein 1a[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | C | R1A_SARS2 Non-structural protein 7[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | C | R1A_SARS2 Non-structural protein 7[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | C | R1A_SARS2 Non-structural protein 7[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | C | R1A_SARS2 Non-structural protein 7[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | C | R1A_SARS2 Non-structural protein 7[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | C | R1A_SARS2 Non-structural protein 7[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | C | R1A_SARS2 Non-structural protein 7[76 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | C | R1A_SARS2 Non-structural protein 7[76 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 8 | |
8gy6 | C | R1A_SARS2 Non-structural protein 7[56 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gy6 | C | R1A_SARS2 Non-structural protein 7[56 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
8sqk | C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
8sqk | C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 | |
6m71 | A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
6m71 | A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | D | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 | |
6nur | A | R1AB_CVHSA NSP12[793 aa] | B | 100.0 /96.5 |
45 /45 |
R1A_CVHSA NSP8 | |
6nur | A | R1AB_CVHSA NSP12[793 aa] | D | 100.0 /96.3 |
2 /2 |
R1A_CVHSA NSP8 | |
6xez | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 | |
6xqb | A | R1AB_SARS2 RNA-directed RNA polymerase[801 aa] | B | 100.0 /100.0 |
36 /36 |
R1AB_SARS2 Non-structural protein 8 | |
6xqb | A | R1AB_SARS2 RNA-directed RNA polymerase[801 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
6yyt | A | R1AB_SARS2 nsp12[853 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 nsp8 | |
6yyt | A | R1AB_SARS2 nsp12[853 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 nsp8 | |
7aap | A | R1AB_SARS2 Non-structural protein 12[911 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 | |
7aap | A | R1AB_SARS2 Non-structural protein 12[911 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7b3b | A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[814 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 | |
7b3c | A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[814 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 | |
7b3d | A | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12[814 .. | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 SARS-CoV-2 nsp8 | |
7btf | A | R1AB_SARS2 RNA-directed RNA polymerase[915 aa] | C | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 Non-structural protein 8 | |
7btf | A | R1AB_SARS2 RNA-directed RNA polymerase[915 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7bv1 | A | R1AB_SARS2 RNA-directed RNA polymerase[836 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 | |
7bv1 | A | R1AB_SARS2 RNA-directed RNA polymerase[836 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7bv2 | A | R1AB_SARS2 RNA-directed RNA polymerase[834 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 | |
7bw4 | A | R1AB_SARS2 RNA-directed RNA polymerase[811 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 | |
7bzf | A | R1AB_SARS2 RNA-directed RNA polymerase[914 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 | |
7bzf | A | R1AB_SARS2 RNA-directed RNA polymerase[914 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7c2k | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 | |
7c2k | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7ctt | A | R1AB_SARS2 RNA-directed RNA polymerase[826 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 | |
7ctt | A | R1AB_SARS2 RNA-directed RNA polymerase[826 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
36 /36 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
7d4f | D | R1AB_SARS2 RNA-directed RNA polymerase[898 aa] | A | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 | |
7d4f | D | R1AB_SARS2 RNA-directed RNA polymerase[898 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7dfg | C | R1AB_SARS2 RNA-directed RNA polymerase[908 aa] | D | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 Non-structural protein 8 | |
7dfg | C | R1AB_SARS2 RNA-directed RNA polymerase[908 aa] | F | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7dfh | A | R1AB_SARS2 RNA-directed RNA polymeras[908 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 | |
7dfh | A | R1AB_SARS2 RNA-directed RNA polymeras[908 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7doi | A | R1AB_SARS2 RNA-directed RNA polymerase[906 aa] | B | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 Non-structural protein 8 | |
7doi | A | R1AB_SARS2 RNA-directed RNA polymerase[906 aa] | F | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7dok | C | R1AB_SARS2 RNA-directed RNA polymerase[925 aa] | D | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 | |
7dok | C | R1AB_SARS2 RNA-directed RNA polymerase[925 aa] | F | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
32 /32 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | I | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | J | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | I | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | L | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7l1f | A | R1AB_SARS2 RNA-directed RNA polymerase[832 aa] | B | 100.0 /100.0 |
36 /36 |
R1AB_SARS2 Non-structural protein 8 | |
7oyg | A | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 SARS-CoV-2 nsp8 | |
7oyg | F | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. | G | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 SARS-CoV-2 nsp8 | |
7ozu | A | R1AB_SARS2 Replicase polyprotein 1ab[814 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 | |
7ozv | A | R1AB_SARS2 Replicase polyprotein 1ab[814 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | G | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | L | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7thm | A | R1AB_SARS2 RNA-directed RNA polymerase[860 aa] | B | 100.0 /100.0 |
35 /35 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | F | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | F | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | B | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | A | R1AB_SARS2 Replicase polyprotein 1ab[928 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | A | R1AB_SARS2 Replicase polyprotein 1ab[928 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
8gy6 | A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | B | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | D | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 | |
8sqk | A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] | B | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 Non-structural protein 8 | |
8sqk | A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | F | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | E | R1AB_SARS2 Helicase[596 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | H | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | I | R1AB_SARS2 Helicase[596 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | H | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | I | R1AB_SARS2 Helicase[596 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | E | R1AB_SARS2 Helicase[588 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | Q | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | E | R1AB_SARS2 Helicase[588 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | M | R1AB_SARS2 Helicase[588 aa] | J | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | R | R1AB_SARS2 Helicase[596 aa] | J | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | J | R1AB_SARS2 Helicase[587 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | K | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | K | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | E | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | N | R1AB_SARS2 Helicase[590 aa] | G | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | M | R1AB_SARS2 Helicase[590 aa] | L | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | H | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | E | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | F | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | E | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | E | R1AB_SARS2 Helicase nsp13[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | F | R1AB_SARS2 Helicase nsp13[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | F | R1AB_SARS2 Helicase nsp13[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | G | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | G | R1AB_SARS2 Helicase[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | G | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | G | R1AB_SARS2 Helicase[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | G | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | G | R1AB_SARS2 Helicase[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | H | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | E | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | F | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | E | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | P | R1AB_SARS2 Proofreading exoribonuclease[524 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7thm | C | R1AB_SARS2 Non-structural protein 7[37 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
6nus | A | R1AB_CVHSA NSP12[715 aa] | B | 100.0 /96.4 |
40 /40 |
R1A_CVHSA NSP8 | |
8urb | A | U6BRU0_9ALPC nsp12[921 aa] | B | 45.0 /44.0 |
40 /40 |
U6BRU0_9ALPC nsp8 | |
8urb | A | U6BRU0_9ALPC nsp12[921 aa] | D | 45.5 /43.3 |
11 /11 |
U6BRU0_9ALPC nsp8 | |
8urb | C | U6BRU0_9ALPC nsp7[70 aa] | B | 33.3 /44.0 |
3 /3 |
U6BRU0_9ALPC nsp8 | |
8urb | C | U6BRU0_9ALPC nsp7[70 aa] | D | 60.0 /43.3 |
20 /21 |
U6BRU0_9ALPC nsp8 | |
3ub0 | B | R1AB_FIPV Non-structural protein 7, nsp7[82 aa] | A | 33.3 /42.7 |
12 /12 |
R1AB_FIPV Non-structural protein 6, nsp6, | |
3ub0 | C | R1AB_FIPV Non-structural protein 7, nsp7[82 aa] | A | 61.3 /42.7 |
31 /31 |
R1AB_FIPV Non-structural protein 6, nsp6, | |
3ub0 | E | R1AB_FIPV Non-structural protein 7, nsp7[81 aa] | D | 30.0 /43.2 |
10 /10 |
R1AB_FIPV Non-structural protein 6, nsp6, | |
3ub0 | F | R1AB_FIPV Non-structural protein 7, nsp7[78 aa] | D | 55.2 /43.2 |
29 /29 |
R1AB_FIPV Non-structural protein 6, nsp6, | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
198 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez | G | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | G | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | G | Product RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | G | Product RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | G | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | G | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | G | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | G | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | G | Product RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | G | Product RNA | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | G | Product RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | G | Product RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | F | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | F | Product RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | H | Product RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | H | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | O | Product RNA | G | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | O | Product RNA | L | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | H | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
6xez | H | Template RNA | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
6yyt | F | RNA product | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp8 | |
6yyt | H | RNA product | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp8 | |
6yyt | F | RNA product | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 nsp8 | |
6yyt | H | RNA product | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 nsp8 | |
6yyt | G | RNA product | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 nsp8 | |
7c2k | E | RNA (29-MER) | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | E | RNA (25-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | E | RNA (25-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | E | Primer RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | E | Primer RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | S | primer RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | S | primer RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | U | primer RNA | J | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | U | primer RNA | L | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | G | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | G | primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | E | RNA (25-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | E | RNA (25-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | I | primer | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | I | primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | I | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | I | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | E | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | E | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | E | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | E | primer | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | E | primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | H | RNA (25-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | H | RNA (25-MER) | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | E | primer | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | E | RNA (25-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | E | RNA (25-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | F | RNA (26-MER) | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7cxm | F | RNA (26-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | F | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7cxn | F | Template RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | E | Primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | E | Primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | F | Template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7cyq | F | Template | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7dok | A | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7dok | A | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7dok | B | RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | F | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | E | RNA (57-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | E | RNA (57-MER) | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | F | RNA (33-MER) | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7dte | F | RNA (33-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | F | RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7ed5 | F | RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | T | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | T | Template RNA | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7egq | V | Template RNA | J | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | H | template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7eiz | H | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | J | template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwe | J | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | F | RNA (37-MER) | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | F | RNA (37-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | G | RNA (37-MER) | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | G | RNA (37-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | E | RNA (37-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | E | RNA (37-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | G | RNA (43-MER) | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7krn | G | RNA (43-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | H | RNA (43-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | H | RNA (43-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | F | RNA (36-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | F | RNA (36-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | H | Template RNA | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | H | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | H | Template RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | H | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | H | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7rdz | H | Template RNA | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | H | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re0 | H | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | H | Template RNA | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | H | Template RNA | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | G | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | I | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | I | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | P | Template RNA | G | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | P | Template RNA | L | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | E | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | E | Product RNA (35-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | F | Template RNA (55-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7uo4 | F | Template RNA (55-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | D | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | D | Product RNA (35-MER) | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | E | Template RNA (55-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uo7 | E | Template RNA (55-MER) | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | D | Product RNA (35-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | D | Product RNA (35-MER) | F | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | E | Template RNA (55-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7uo9 | E | Template RNA (55-MER) | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | G | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | E | Product RNA (35-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | E | Product RNA (35-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | E | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | E | Product RNA (35-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | F | Template RNA (55-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7uob | F | Template RNA (55-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | F | Template RNA (55-MER) | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
7uoe | F | Template RNA (55-MER) | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | F | Template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gw1 | F | Template | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | F | template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwk | F | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | I | RNA (26-MER) | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwm | I | RNA (26-MER) | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | J | template | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 | |
8gwb | J | template | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | F | template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwf | F | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | F | Template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwg | F | Template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | F | RNA (27-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8gwi | F | RNA (27-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | F | template | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwn | F | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | F | template | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8gwo | F | template | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | F | Primer RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8sq9 | F | Primer RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | F | Primer RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | F | Primer RNA | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | G | Template RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
8sqj | G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8sqk | F | Primer RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8sqk | G | Template RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
8sqk | G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
8urb | E | RNA (33-MER) | B | 50.0 /44.0 |
2 /2 |
U6BRU0_9ALPC nsp8 | |
8urb | E | RNA (33-MER) | D | 66.7 /43.3 |
3 /3 |
U6BRU0_9ALPC nsp8 | |
8urb | F | RNA (55-MER) | D | 100.0 /43.3 |
2 /2 |
U6BRU0_9ALPC nsp8 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
198 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7krn | T |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7kro | U |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7krp | M |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7rdx | U |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7rdy | O |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7re1 | U |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
7re2 | T |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | AA |
1N7
CHAPSO[36 atoms] |
D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
7re3 | RA |
1N7
CHAPSO[36 atoms] |
L | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
198 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | E | 100.0 /97.4 |
19 /19 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | E | 100.0 /97.4 |
19 /19 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | F | 100.0 /97.2 |
18 /18 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | F | 100.0 /97.2 |
18 /18 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | G | 100.0 /97.4 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | G | 100.0 /97.4 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | H | 100.0 /97.4 |
11 /11 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | H | 100.0 /97.4 |
11 /11 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
8urb | D | U6BRU0_9ALPC nsp8[184 aa] | B | 0.0 /44.0 |
1 /1 |
U6BRU0_9ALPC nsp8 | |
8urb | B | U6BRU0_9ALPC nsp8[184 aa] | D | 0.0 /43.3 |
1 /1 |
U6BRU0_9ALPC nsp8 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
198 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6wqd | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
6wqd | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
6xip | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
6wtc | E |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 | |
6wtc | F |
ACY
ACETIC ACID[4 atoms] |
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 | |
2ahm | N |
SO4
SULFATE ION[5 atoms] |
H | 75.0 /97.4 |
4 /4 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | N |
SO4
SULFATE ION[5 atoms] |
H | 75.0 /97.4 |
4 /4 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | I |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | I |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | I |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | I |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | J |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | J |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | K |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | K |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | K |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | K |
GOL
GLYCEROL[6 atoms] |
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | L |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /97.2 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | L |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /97.2 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | L |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /97.2 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | L |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /97.2 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | M |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
2ahm | M |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |