Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
31126 | 468 | 11 | P08887(IL6RA_HUMAN) | RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor; |
QUERYSEQ |
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA RDPRSPYDISNTDYFFPR |
468 | region | name | description |
1-19 | SIGNAL | ||
20-468 | CHAIN | /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895" | |
20-355 | CHAIN | /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730" | |
20-365 | TOPO_DOM | /note="Extracellular" | |
366-386 | TRANSMEM | /note="Helical" | |
387-468 | TOPO_DOM | /note="Cytoplasmic" | |
26-112 | DOMAIN | /note="Ig-like C2-type" | |
113-217 | DOMAIN | /note="Fibronectin type-III 1" | |
218-316 | DOMAIN | /note="Fibronectin type-III 2" | |
303-328 | REGION | /note="Disordered" | |
421-468 | REGION | /note="Disordered" | |
311-328 | COMPBIAS | /note="Polar residues" | |
1-468 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
468 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
1n26 | A | 100.0 | IL6A_HUMAN IL-6 Receptor alpha chain | ||||
8d82 | A | 100.0 | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | ||||
8d82 | D | 100.0 | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | ||||
1p9m | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor alpha chain | ||||
8qy6 | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8qy5 | E | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8qy5 | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8qy6 | E | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
2arw | A | 100.0 | IL6RA_HUMAN Interleukin-6 receptor alpha chain | ||||
8iow | A | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
8j6f | C | 100.0 | IL6RA_HUMAN Interleukin-6 receptor subunit alpha | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | A | IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] | C | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | C | 100.0 /100.0 |
15 /15 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
1p9m | B | IL6_HUMAN Interleukin-6[163 aa] | C | 100.0 /100.0 |
15 /15 |
IL6RA_HUMAN Interleukin-6 receptor alpha chain | |
8d82 | B | IL6_HUMAN Interleukin-6[169 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | E | IL6_HUMAN Interleukin-6[169 aa] | D | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8qy5 | B | IL6_HUMAN Interleukin-6[157 aa] | C | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | D | IL6_HUMAN Interleukin-6[157 aa] | E | 100.0 /100.0 |
10 /10 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | B | IL6_HUMAN Interleukin-6[157 aa] | C | 100.0 /100.0 |
10 /10 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | D | IL6_HUMAN Interleukin-6[157 aa] | E | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8d82 | C | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | F | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | A | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | C | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | D | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | F | IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] | D | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8iow | C | Light chain of Sarilumab Fab[212 aa] | A | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | B | Light chain of Tocilizumab Fab[209 aa] | C | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8iow | D | Heavy chain of Sarilumab Fab[207 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | A | Heavy chain of Tocilizumab Fab[211 aa] | C | 100.0 /100.0 |
14 /14 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | D | IL6RA_HUMAN IL6R-D2 peptide[10 aa] | C | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
14 /14 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
4 /4 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy5 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
13 /13 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
13 /13 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | C | 100.0 /100.0 |
10 /10 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | A | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
5 /5 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8qy6 | F | IL6RB_MOUSE Interleukin-6 receptor subunit beta[584 aa] | E | 100.0 /100.0 |
11 /11 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1n26 | D |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | D |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
8d82 | Q |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | R |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | S |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | AA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | BA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | Z |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
6 /6 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8iow | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8iow | F |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
8j6f | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
1 /1 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
1n26 | H |
CYS
CYSTEINE[7 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | H |
CYS
CYSTEINE[7 atoms] |
A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1n26 | B | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. | A | 100.0 /100.0 |
9 /9 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | B | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. | A | 100.0 /100.0 |
9 /9 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
8d82 | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
1 /1 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
8d82 | L | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | D | 100.0 /100.0 |
1 /1 |
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1n26 | A | IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] | A | 100.0 /100.0 |
11 /11 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | A | IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] | A | 100.0 /100.0 |
15 /15 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
8iow | B | IL6RA_HUMAN Interleukin-6 receptor subunit alpha[14 aa] | A | 100.0 /100.0 |
8 /8 |
IL6RA_HUMAN Interleukin-6 receptor subunit alpha | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
468 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1n26 | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
1n26 | G |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
IL6A_HUMAN IL-6 Receptor alpha chain | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |