HOMCOS(prot_sch_conbars.cgi):

#WARNING:no index is registered index "YP_009725308.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725308.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

884958

601

164

YP_009725308.1()

QUERYSEQ

AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYG
IATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP
SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVD
TVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATL
Q

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725308.1()]

601
	region	name	description
	1-601	DISORDER	predicted by DISOPRED

MONOMER

601

pdb_id a¹ identity[%]² description

7egq R 100.0 R1AB_SARS2 Helicase

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

601 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6xez[22] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] E 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

7cxn[1] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] H 100.0
/100.0 1
/1 R1AB_SARS2 Helicase

7egq[2] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] E 100.0
/100.0 1
/1 R1AB_SARS2 Helicase

7re3[2] J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] F 100.0
/100.0 10
/10 R1AB_SARS2 Helicase

6xez[6] C R1AB_SARS2 Non-structural protein 7[73 aa] E 100.0
/100.0 1
/1 R1AB_SARS2 Helicase

7egq[2] C R1AB_SARS2 Non-structural protein 7[72 aa] E 100.0
/100.0 1
/1 R1AB_SARS2 Helicase

6xez[19] D R1AB_SARS2 Non-structural protein 8[186 aa] E 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

7cxm[22] B R1AB_SARS2 Non-structural protein 8[187 aa] H 100.0
/100.0 11
/11 R1AB_SARS2 Helicase

7cxm[3] D R1AB_SARS2 Non-structural protein 8[186 aa] I 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

7cyq[9] B R1AB_SARS2 Non-structural protein 8[187 aa] G 100.0
/100.0 2
/2 R1AB_SARS2 Helicase

7egq[2] B R1AB_SARS2 Non-structural protein 8[187 aa] E 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

7rdz[1] D R1AB_SARS2 Non-structural protein 8[185 aa] E 100.0
/100.0 1
/1 R1AB_SARS2 Helicase

7re0[1] B R1AB_SARS2 Non-structural protein 8[186 aa] E 100.0
/100.0 2
/2 R1AB_SARS2 Helicase

7egq[2] P R1AB_SARS2 Proofreading exoribonuclease[524 aa] E 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

601 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7cxm[2] G RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') I 100.0
/100.0 20
/20 R1AB_SARS2 Helicase

7egq[1] T Template RNA E 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

7krn[2] G RNA (43-MER) E 100.0
/100.0 32
/32 R1AB_SARS2 Helicase

7rdx[1] H Template RNA E 100.0
/100.0 10
/10 R1AB_SARS2 Helicase

7rdy[1] H Template RNA E 100.0
/100.0 30
/30 R1AB_SARS2 Helicase

8gwb[5] F template G 100.0
/100.0 1
/1 R1AB_SARS2 Helicase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

601 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5rl6[1] H LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms] B 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rl7[1] C VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rl7[1] I VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms] B 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5rl8[1] C VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms] A 100.0
/100.0 10
/10 R1AB_SARS2 Helicase

5rl8[1] D VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rl9[1] H UR7
1-(3-fluoro-4-methylphenyl)methanesulfonamide[13 a.. B 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5rlb[1] C VVJ
N-cycloheptyl-N-methylmethanesulfonamide[13 atoms].. A 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5rlc[1] H VVM
4-amino-N-phenylbenzene-1-sulfonamide[17 atoms] B 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rld[1] H VVY
2-phenoxy-1-(pyrrolidin-1-yl)ethan-1-one[15 atoms].. B 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rle[1] H VVP
4-methoxy-1H-indole[11 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5rlf[1] C NY7
N-(2-methoxy-5-methylphenyl)glycinamide[14 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5rlg[1] C VW1
(2S)-2-(4-cyanophenoxy)propanamide[14 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rlh[1] H K2P
2-(trifluoromethoxy)benzoic acid[14 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rli[2] C JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms] A 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rli[1] I JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms] B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rlj[1] H VW4
(2S)-2-phenylpropane-1-sulfonamide[13 atoms] B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rlk[1] H NYV
1-(propan-2-yl)-1H-imidazole-4-sulfonamide[12 atom.. B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rll[1] H H04
1-(2-ethoxyphenyl)piperazine[15 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5rlm[1] H VW7
N-(8-methyl-1,2,3,4-tetrahydroquinolin-5-yl)acetam.. B 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

5rln[1] C NZG
3-(acetylamino)-4-fluorobenzoic acid[14 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rlo[1] H UQS
N-[(2-fluorophenyl)methyl]-1H-pyrazol-4-amine[14 a.. B 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rlp[1] H VWA
(1S)-1-(4-fluorophenyl)-N-methylethan-1-amine[11 a.. B 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5rlq[1] C UVA
N-methyl-2-(methylsulfonyl)aniline[12 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rlr[1] H VWD
(1R)-2-(methylsulfonyl)-1-phenylethan-1-ol[13 atom.. B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rls[1] C VWG
N-hydroxyquinoline-2-carboxamide[14 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5rlt[1] H UVJ
3-(2-methyl-1H-benzimidazol-1-yl)propanamide[15 at.. B 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rlu[1] C JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

5rlu[1] I JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rlv[1] C VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rlv[1] D VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rlv[1] J VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5rlw[1] C S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1.. A 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rlw[1] I S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1.. B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rly[1] C K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5rly[1] I K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5rly[1] J K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rlz[1] C VWM
(3R)-1-acetyl-3-hydroxypiperidine-3-carboxylic aci.. A 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rm0[1] H S7G
~{N}-[(3~{R})-1,2,3,4-tetrahydroquinolin-3-yl]etha.. B 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rm1[1] H RY4
N-[4-(aminomethyl)phenyl]methanesulfonamide[13 ato.. B 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rm2[1] H UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms] B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rm2[1] I UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rm3[1] C S7J
2-(trifluoromethyl)pyrimidine-5-carboxamide[13 ato.. A 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rm4[1] H PK4
2-fluoro-N,3-dimethylbenzene-1-sulfonamide[13 atom.. B 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rm5[1] H NUA
N-(1-ethyl-1H-pyrazol-4-yl)cyclobutanecarboxamide[.. B 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rm6[1] H HR5
~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-ca.. B 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rm7[1] H N0E
~{N}-(4-hydroxyphenyl)-3-phenyl-propanamide[18 ato.. B 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rm8[1] C GQJ
methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxid.. A 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rm9[1] H EJQ
~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide.. B 100.0
/100.0 10
/10 R1AB_SARS2 Helicase

5rma[1] H JHJ
N-(4-methoxyphenyl)-N'-pyridin-4-ylurea[18 atoms] B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rmb[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta.. A 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5rmc[1] H 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms] B 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rmd[2] C VWY
N-ethyl-4-[(methylsulfonyl)amino]benzamide[16 atom.. A 100.0
/100.0 9
/9 R1AB_SARS2 Helicase

5rme[1] C RYM
4-(benzimidazol-1-ylmethyl)benzenecarbonitrile[18 .. A 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rmf[1] C NX7
(2,6-difluorophenyl)(pyrrolidin-1-yl)methanone[15 .. A 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rmg[1] H MUK
4,6-dimethyl-~{N}-phenyl-pyrimidin-2-amine[15 atom.. B 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rmh[1] C VX4
[(4S)-4-methylazepan-1-yl](1,3-thiazol-4-yl)methan.. A 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

5rmi[1] C STV
~{N}-(1,3-benzodioxol-5-ylmethyl)ethanesulfonamide.. A 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

5rmj[1] C JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. A 100.0
/100.0 10
/10 R1AB_SARS2 Helicase

5rmk[1] H O2A
N-methyl-1H-indole-7-carboxamide[13 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

5rml[1] H VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms] B 100.0
/100.0 8
/8 R1AB_SARS2 Helicase

5rmm[1] H VXG
(3S,4R)-1-acetyl-4-phenylpyrrolidine-3-carboxylic .. B 100.0
/100.0 10
/10 R1AB_SARS2 Helicase

6xez[18] R ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] E 100.0
/100.0 10
/10 R1AB_SARS2 Helicase

6xez[9] U 1N7
CHAPSO[36 atoms] E 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

7nn0[4] E ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato.. A 100.0
/100.0 16
/16 R1AB_SARS2 SARS-CoV-2 helicase NSP13

7nng[2] C UJK
1-(2-methylphenyl)-1,2,3-triazole-4-carboxylic aci.. A 100.0
/100.0 8
/8 R1AB_SARS2 SARS-CoV-2 helicase NSP13

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

601 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5rl6[144] C ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5rl6[132] D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5rl6[132] E ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

5wwp[12] C ZN
ZINC ION[1 atoms] A 100.0
/72.3 4
/4 K0BWD0_9BETC ORF1ab

5wwp[12] D ZN
ZINC ION[1 atoms] A 100.0
/72.3 4
/4 K0BWD0_9BETC ORF1ab

6xez[20] O ZN
ZINC ION[1 atoms] E 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

6xez[20] P ZN
ZINC ION[1 atoms] E 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

6xez[20] Q ZN
ZINC ION[1 atoms] E 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

6xez[19] T MG
MAGNESIUM ION[1 atoms] E 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

601 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6xez[18] F R1AB_SARS2 Helicase[596 aa] E 100.0
/100.0 4
/4 R1AB_SARS2 Helicase

6xez[8] E R1AB_SARS2 Helicase[596 aa] F 100.0
/100.0 5
/5 R1AB_SARS2 Helicase

7cxm[2] H R1AB_SARS2 Helicase[596 aa] I 100.0
/100.0 3
/3 R1AB_SARS2 Helicase

7cyq[10] G R1AB_SARS2 Helicase[585 aa] H 100.0
/100.0 1
/1 R1AB_SARS2 Helicase

7nio[2] B R1AB_SARS2 SARS-CoV-2 helicase NSP13[585 aa] A 100.0
/100.0 14
/14 R1AB_SARS2 SARS-CoV-2 helicase NSP13

7rdx[3] E R1AB_SARS2 Helicase[590 aa] F 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

7re0[1] F R1AB_SARS2 Helicase[590 aa] E 100.0
/100.0 6
/6 R1AB_SARS2 Helicase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

601 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5rl6[216] F PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

6xez[18] S AF3
ALUMINUM FLUORIDE[4 atoms] E 100.0
/100.0 7
/7 R1AB_SARS2 Helicase

5wwp[3] F SO4
SULFATE ION[5 atoms] A 100.0
/72.3 5
/5 K0BWD0_9BETC ORF1ab

5wwp[1] J SO4
SULFATE ION[5 atoms] B 100.0
/72.6 6
/6 K0BWD0_9BETC ORF1ab

5wwp[1] K SO4
SULFATE ION[5 atoms] B 100.0
/72.6 4
/4 K0BWD0_9BETC ORF1ab

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
601
	pdb_id	a¹	identity[%]²	description
	7egq	R	100.0	R1AB_SARS2 Helicase
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
601	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6xez[22]	A	R1AB_SARS2 RNA-directed RNA polymerase[926 aa]	E	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	7cxn[1]	A	R1AB_SARS2 RNA-directed RNA polymerase[926 aa]	H	100.0 /100.0	1 /1	R1AB_SARS2 Helicase
	7egq[2]	A	R1AB_SARS2 RNA-directed RNA polymerase[926 aa]	E	100.0 /100.0	1 /1	R1AB_SARS2 Helicase
	7re3[2]	J	R1AB_SARS2 RNA-directed RNA polymerase[927 aa]	F	100.0 /100.0	10 /10	R1AB_SARS2 Helicase
	6xez[6]	C	R1AB_SARS2 Non-structural protein 7[73 aa]	E	100.0 /100.0	1 /1	R1AB_SARS2 Helicase
	7egq[2]	C	R1AB_SARS2 Non-structural protein 7[72 aa]	E	100.0 /100.0	1 /1	R1AB_SARS2 Helicase
	6xez[19]	D	R1AB_SARS2 Non-structural protein 8[186 aa]	E	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	7cxm[22]	B	R1AB_SARS2 Non-structural protein 8[187 aa]	H	100.0 /100.0	11 /11	R1AB_SARS2 Helicase
	7cxm[3]	D	R1AB_SARS2 Non-structural protein 8[186 aa]	I	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	7cyq[9]	B	R1AB_SARS2 Non-structural protein 8[187 aa]	G	100.0 /100.0	2 /2	R1AB_SARS2 Helicase
	7egq[2]	B	R1AB_SARS2 Non-structural protein 8[187 aa]	E	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	7rdz[1]	D	R1AB_SARS2 Non-structural protein 8[185 aa]	E	100.0 /100.0	1 /1	R1AB_SARS2 Helicase
	7re0[1]	B	R1AB_SARS2 Non-structural protein 8[186 aa]	E	100.0 /100.0	2 /2	R1AB_SARS2 Helicase
	7egq[2]	P	R1AB_SARS2 Proofreading exoribonuclease[524 aa]	E	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
601	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7cxm[2]	G	RNA (5'-R(PUPUPUPUPUPU)-3')	I	100.0 /100.0	20 /20	R1AB_SARS2 Helicase
	7egq[1]	T	Template RNA	E	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	7krn[2]	G	RNA (43-MER)	E	100.0 /100.0	32 /32	R1AB_SARS2 Helicase
	7rdx[1]	H	Template RNA	E	100.0 /100.0	10 /10	R1AB_SARS2 Helicase
	7rdy[1]	H	Template RNA	E	100.0 /100.0	30 /30	R1AB_SARS2 Helicase
	8gwb[5]	F	template	G	100.0 /100.0	1 /1	R1AB_SARS2 Helicase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
601	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5rl6[1]	H	LJA N-[3-(carbamoylamino)phenyl]acetamide[14 atoms]	B	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rl7[1]	C	VVD 5-(acetylamino)-2-fluorobenzoic acid[14 atoms]	A	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rl7[1]	I	VVD 5-(acetylamino)-2-fluorobenzoic acid[14 atoms]	B	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5rl8[1]	C	VVG N-(2-fluorophenyl)ethanesulfonamide[13 atoms]	A	100.0 /100.0	10 /10	R1AB_SARS2 Helicase
	5rl8[1]	D	VVG N-(2-fluorophenyl)ethanesulfonamide[13 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rl9[1]	H	UR7 1-(3-fluoro-4-methylphenyl)methanesulfonamide[13 a..	B	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5rlb[1]	C	VVJ N-cycloheptyl-N-methylmethanesulfonamide[13 atoms]..	A	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5rlc[1]	H	VVM 4-amino-N-phenylbenzene-1-sulfonamide[17 atoms]	B	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rld[1]	H	VVY 2-phenoxy-1-(pyrrolidin-1-yl)ethan-1-one[15 atoms]..	B	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rle[1]	H	VVP 4-methoxy-1H-indole[11 atoms]	B	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5rlf[1]	C	NY7 N-(2-methoxy-5-methylphenyl)glycinamide[14 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5rlg[1]	C	VW1 (2S)-2-(4-cyanophenoxy)propanamide[14 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rlh[1]	H	K2P 2-(trifluoromethoxy)benzoic acid[14 atoms]	B	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rli[2]	C	JFM N-(2-phenylethyl)methanesulfonamide[13 atoms]	A	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rli[1]	I	JFM N-(2-phenylethyl)methanesulfonamide[13 atoms]	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rlj[1]	H	VW4 (2S)-2-phenylpropane-1-sulfonamide[13 atoms]	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rlk[1]	H	NYV 1-(propan-2-yl)-1H-imidazole-4-sulfonamide[12 atom..	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rll[1]	H	H04 1-(2-ethoxyphenyl)piperazine[15 atoms]	B	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5rlm[1]	H	VW7 N-(8-methyl-1,2,3,4-tetrahydroquinolin-5-yl)acetam..	B	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	5rln[1]	C	NZG 3-(acetylamino)-4-fluorobenzoic acid[14 atoms]	A	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rlo[1]	H	UQS N-[(2-fluorophenyl)methyl]-1H-pyrazol-4-amine[14 a..	B	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rlp[1]	H	VWA (1S)-1-(4-fluorophenyl)-N-methylethan-1-amine[11 a..	B	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5rlq[1]	C	UVA N-methyl-2-(methylsulfonyl)aniline[12 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rlr[1]	H	VWD (1R)-2-(methylsulfonyl)-1-phenylethan-1-ol[13 atom..	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rls[1]	C	VWG N-hydroxyquinoline-2-carboxamide[14 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5rlt[1]	H	UVJ 3-(2-methyl-1H-benzimidazol-1-yl)propanamide[15 at..	B	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rlu[1]	C	JG4 2-(thiophen-2-yl)-1H-imidazole[10 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	5rlu[1]	I	JG4 2-(thiophen-2-yl)-1H-imidazole[10 atoms]	B	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rlv[1]	C	VWJ N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rlv[1]	D	VWJ N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rlv[1]	J	VWJ N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]	B	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5rlw[1]	C	S9S ~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..	A	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rlw[1]	I	S9S ~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rly[1]	C	K34 5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5rly[1]	I	K34 5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]	B	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5rly[1]	J	K34 5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]	B	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rlz[1]	C	VWM (3R)-1-acetyl-3-hydroxypiperidine-3-carboxylic aci..	A	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rm0[1]	H	S7G ~{N}-[(3~{R})-1,2,3,4-tetrahydroquinolin-3-yl]etha..	B	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rm1[1]	H	RY4 N-[4-(aminomethyl)phenyl]methanesulfonamide[13 ato..	B	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rm2[1]	H	UXG 1-(diphenylmethyl)azetidin-3-ol[18 atoms]	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rm2[1]	I	UXG 1-(diphenylmethyl)azetidin-3-ol[18 atoms]	B	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rm3[1]	C	S7J 2-(trifluoromethyl)pyrimidine-5-carboxamide[13 ato..	A	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rm4[1]	H	PK4 2-fluoro-N,3-dimethylbenzene-1-sulfonamide[13 atom..	B	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rm5[1]	H	NUA N-(1-ethyl-1H-pyrazol-4-yl)cyclobutanecarboxamide[..	B	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rm6[1]	H	HR5 ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-ca..	B	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rm7[1]	H	N0E ~{N}-(4-hydroxyphenyl)-3-phenyl-propanamide[18 ato..	B	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rm8[1]	C	GQJ methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxid..	A	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rm9[1]	H	EJQ ~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide..	B	100.0 /100.0	10 /10	R1AB_SARS2 Helicase
	5rma[1]	H	JHJ N-(4-methoxyphenyl)-N'-pyridin-4-ylurea[18 atoms]	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rmb[1]	C	VWV ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta..	A	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5rmc[1]	H	6SU methyl 3-(methylsulfonylamino)benzoate[15 atoms]	B	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rmd[2]	C	VWY N-ethyl-4-[(methylsulfonyl)amino]benzamide[16 atom..	A	100.0 /100.0	9 /9	R1AB_SARS2 Helicase
	5rme[1]	C	RYM 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile[18 ..	A	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rmf[1]	C	NX7 (2,6-difluorophenyl)(pyrrolidin-1-yl)methanone[15 ..	A	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rmg[1]	H	MUK 4,6-dimethyl-~{N}-phenyl-pyrimidin-2-amine[15 atom..	B	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rmh[1]	C	VX4 [(4S)-4-methylazepan-1-yl](1,3-thiazol-4-yl)methan..	A	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	5rmi[1]	C	STV ~{N}-(1,3-benzodioxol-5-ylmethyl)ethanesulfonamide..	A	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	5rmj[1]	C	JOV 3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid..	A	100.0 /100.0	10 /10	R1AB_SARS2 Helicase
	5rmk[1]	H	O2A N-methyl-1H-indole-7-carboxamide[13 atoms]	B	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	5rml[1]	H	VXD N-(3-chloro-2-methylphenyl)glycinamide[13 atoms]	B	100.0 /100.0	8 /8	R1AB_SARS2 Helicase
	5rmm[1]	H	VXG (3S,4R)-1-acetyl-4-phenylpyrrolidine-3-carboxylic ..	B	100.0 /100.0	10 /10	R1AB_SARS2 Helicase
	6xez[18]	R	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	E	100.0 /100.0	10 /10	R1AB_SARS2 Helicase
	6xez[9]	U	1N7 CHAPSO[36 atoms]	E	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	7nn0[4]	E	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..	A	100.0 /100.0	16 /16	R1AB_SARS2 SARS-CoV-2 helicase NSP13
	7nng[2]	C	UJK 1-(2-methylphenyl)-1,2,3-triazole-4-carboxylic aci..	A	100.0 /100.0	8 /8	R1AB_SARS2 SARS-CoV-2 helicase NSP13
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
601	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5rl6[144]	C	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5rl6[132]	D	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5rl6[132]	E	ZN ZINC ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	5wwp[12]	C	ZN ZINC ION[1 atoms]	A	100.0 /72.3	4 /4	K0BWD0_9BETC ORF1ab
	5wwp[12]	D	ZN ZINC ION[1 atoms]	A	100.0 /72.3	4 /4	K0BWD0_9BETC ORF1ab
	6xez[20]	O	ZN ZINC ION[1 atoms]	E	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	6xez[20]	P	ZN ZINC ION[1 atoms]	E	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	6xez[20]	Q	ZN ZINC ION[1 atoms]	E	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	6xez[19]	T	MG MAGNESIUM ION[1 atoms]	E	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
601	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6xez[18]	F	R1AB_SARS2 Helicase[596 aa]	E	100.0 /100.0	4 /4	R1AB_SARS2 Helicase
	6xez[8]	E	R1AB_SARS2 Helicase[596 aa]	F	100.0 /100.0	5 /5	R1AB_SARS2 Helicase
	7cxm[2]	H	R1AB_SARS2 Helicase[596 aa]	I	100.0 /100.0	3 /3	R1AB_SARS2 Helicase
	7cyq[10]	G	R1AB_SARS2 Helicase[585 aa]	H	100.0 /100.0	1 /1	R1AB_SARS2 Helicase
	7nio[2]	B	R1AB_SARS2 SARS-CoV-2 helicase NSP13[585 aa]	A	100.0 /100.0	14 /14	R1AB_SARS2 SARS-CoV-2 helicase NSP13
	7rdx[3]	E	R1AB_SARS2 Helicase[590 aa]	F	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	7re0[1]	F	R1AB_SARS2 Helicase[590 aa]	E	100.0 /100.0	6 /6	R1AB_SARS2 Helicase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
601	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5rl6[216]	F	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	6xez[18]	S	AF3 ALUMINUM FLUORIDE[4 atoms]	E	100.0 /100.0	7 /7	R1AB_SARS2 Helicase
	5wwp[3]	F	SO4 SULFATE ION[5 atoms]	A	100.0 /72.3	5 /5	K0BWD0_9BETC ORF1ab
	5wwp[1]	J	SO4 SULFATE ION[5 atoms]	B	100.0 /72.6	6 /6	K0BWD0_9BETC ORF1ab
	5wwp[1]	K	SO4 SULFATE ION[5 atoms]	B	100.0 /72.6	4 /4	K0BWD0_9BETC ORF1ab
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [YP_009725308.1()]