#WARNING:no index is registered index "YP_009725299.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725299.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4056802 1945 500 YP_009725299.1()
QUERYSEQ
APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAA
LQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVV
GPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSA
TLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY
GARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
KVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYC
NKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY
KENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKP
VETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNY
MPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDL
TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDE
VARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEA
ELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725299.1()]

1945
region name description
1-1945 DISORDER predicted by DISOPRED

MONOMER
1945
pdb_id a1 identity[%]2 description
6wuu A 99.7 R1AB_SARS2 Non-structural protein 3
8f2e A 100.0 R1AB_SARS2 Papain-like protease nsp3
8hbl A 99.2 R1A_SARS2 Non-structural protein 3
6z72 C 100.0 R1AB_SARS2 Replicase polyprotein 1ab
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5tl6[5] D ISG15_HUMAN Ubiquitin-like protein ISG15[78 aa] A 100.0
/82.9
21
/21
R1AB_CVHSA Replicase polyprotein 1ab
8cx9[8] G RL40_HUMAN Ubiquitin variant UbV.CV2.1[75 aa] A 100.0
/100.0
12
/12
R1A_SARS2 Papain-like protease nsp3
8iho[2] C covalent inhibitor[4 aa] A 100.0
/100.0
18
/18
R1A_SARS2 Papain-like protease nsp3
8iho[1] D covalent inhibitor[4 aa] A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
7rbs[5] B ISG15_HUMAN Ubiquitin-like protein ISG15[157 aa] A 96.7
/99.7
30
/30
R1A_SARS2 Papain-like protease
6yva[1] B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 96.6
/99.6
29
/29
R1A_SARS2 Replicase polyprotein 1a
4m0w[7] B RS27A_BOVIN Ubiquitin[76 aa] A 88.5
/82.3
26
/26
R1A_CVHSA Replicase polyprotein 1a
5e6j[2] C UBB_HUMAN Polyubiquitin-B[75 aa] A 63.6
/82.0
11
/11
R1AB_CVHSA Replicase polyprotein 1ab
7uv5[1] C UBB_HUMAN Ubiquitin[41 aa] A 100.0
/99.4
10
/10
R1A_SARS2 Papain-like protease nsp3
6wuu[8] E VIR250[5 aa] A 100.0
/99.7
18
/18
R1AB_SARS2 Non-structural protein 3
5tl7[2] A ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] B 92.6
/82.9
27
/27
R1AB_CVHSA Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5ruv[1] C W6J
1-(pyridin-2-yl)-1,4-diazepane[13 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rv9[1] D EKZ
4-tert-butylbenzene-1,2-diol[12 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rvi[1] D CLW
CHLORZOXAZONE[11 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rvj[1] B 4JQ
6-amino-2H-chromen-2-one[12 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvk[1] B 2AK
7-bromo-5-methyl-1H-indole-2,3-dione[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvl[1] B BVF
4-METHYLPYRIDIN-2-AMINE[8 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvm[1] B HBD
4-HYDROXYBENZAMIDE[10 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvn[1] B ANN
4-METHOXYBENZOIC ACID[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rvo[1] B AQO
2-AMINOQUINAZOLIN-4(3H)-ONE[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rvp[1] B 1SQ
ISOQUINOLIN-1-AMINE[11 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvq[1] B 4BY
5-methyl-1H-indole-2-carboxylic acid[13 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5rvr[1] B LZ1
1H-indazole[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5rvs[1] B 0LO
5-phenylpyridine-3-carboxylic acid[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rvt[1] B 4BL
6-methyl-1H-indole-2-carboxylic acid[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvu[1] B 6P3
6-phenylpyridine-3-carboxylic acid[15 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5rvv[1] B WB1
6-methyl-1H-indole-3-carboxylic acid[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5s1a[1] D WPS
5-amino-3-methyl-1H-pyrazole-4-carbonitrile[9 atom..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s27[1] C WSM
4-(3-aminopropyl)-2H-1,4-benzoxazin-3(4H)-one[15 a..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s2d[1] C U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s2h[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta..
B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5s2i[1] C LUY
~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine[18..
B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5s2j[1] C JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s2l[1] D VZS
N-(2-methoxy-5-methylphenyl)-N'-4H-1,2,4-triazol-4..
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s2u[1] C VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5s2v[1] C W0G
(3R)-1-(2-fluorophenyl)-3-(methylamino)pyrrolidin-..
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5s2x[1] C W0J
(3R)-N-methyl-1-(pyridazin-3-yl)piperidin-3-amine[..
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s2y[1] C W0M
(2R)-2-(4-chlorophenoxy)propanamide[13 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s31[1] C W0S
1-(3,4,5-trimethoxyphenyl)methanamine[14 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s36[1] D 7ZC
1-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-methanami..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s3i[1] C W1P
5-methyl-2-phenyl-2,4-dihydro-3H-pyrazol-3-one[13 ..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s3q[1] D W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca..
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5s3q[1] E W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca..
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5s3r[1] C W24
(2S,3S)-N,2-dimethyl-1-(methylsulfonyl)piperidine-..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s3t[1] E W2G
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxylic..
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s3v[1] C W2M
(2R)-1',4'-dihydro-2'H-spiro[pyrrolidine-2,3'-quin..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s3w[1] C W2S
(3R,4R)-4-(2-methylphenyl)oxolane-3-carboxylic aci..
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s3y[1] C W2Y
(2S,3S)-2-methyl-1-(methylsulfonyl)piperidine-3-ca..
B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5s43[1] C UUJ
5-bromo-2-hydroxybenzonitrile[10 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5s48[1] E HRZ
1~{H}-pyridin-2-one[7 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5s4a[1] D 4AP
4-AMINOPYRIDINE[7 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
5s4a[1] E 4AP
4-AMINOPYRIDINE[7 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s4a[1] F 4AP
4-AMINOPYRIDINE[7 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s4c[1] H W3J
1,4,5,6-tetrahydropyrimidin-2-amine[7 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s4c[1] I W3J
1,4,5,6-tetrahydropyrimidin-2-amine[7 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5s4e[1] F W3M
1H-imidazole-5-carbonitrile[7 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5s4k[1] C W44
(2S,5R,6R)-7-methyl-2,3,4,5,6,7-hexahydro-1H-2,6-m..
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
6w6y[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 Non-structural protein 3
6woj[15] E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
A 100.0
/100.0
21
/21
R1AB_SARS2 Non-structural protein 3
6z6i[5] E A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID..
A 100.0
/100.0
22
/22
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] X A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID..
C 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] O MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
8azc[1] C MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
6z72[4] E A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m..
A 100.0
/100.0
23
/23
R1AB_SARS2 Replicase polyprotein 1ab
6z72[1] R MLT
D-MALATE[9 atoms]
D 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
7bf3[2] I ADN
ADENOSINE[19 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 NSP3 macrodomain
7bf4[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 NSP3 macrodomain
7bf5[4] G A2R
[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY..
A 100.0
/100.0
23
/23
R1AB_SARS2 NSP3 macrodomain
7bf6[4] D U08
(2~{R},3~{R},4~{S},5~{R})-2-(4-azanylpyrrolo[2,1-f..
A 100.0
/100.0
13
/13
R1AB_SARS2 Papain-like protease nsp3
7jiv[2] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7kok[2] B Y96
5-[(E)-(hydroxyimino)methyl]-2-methyl-N-[(1R)-1-(n..
A 100.0
/99.7
10
/10
R1A_SARS2 Papain-like protease
7lbr[2] F XT7
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1S,3R..
A 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
7lbs[2] C XR8
5-[(azetidin-3-yl)amino]-2-methyl-N-[(1R)-1-(3-{5-..
A 100.0
/100.0
12
/12
R1A_SARS2 Non-structural protein 3
7llf[2] I Y54
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1R,3S..
A 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
7llz[2] C Y61
N-[(1R)-1-(3-{5-[(acetylamino)methyl]thiophen-2-yl..
A 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
7los[2] E Y97
5-(azetidin-3-ylamino)-2-methyl-~{N}-[(1~{R})-1-[3..
A 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
7nt4[4] C PRL
PROFLAVIN[16 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
7nt4[2] E PRL
PROFLAVIN[16 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
7ofs[1] E YRL
4-(2-hydroxyethyl)phenol[10 atoms]
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-like protease nsp3
7oft[1] K HBA
P-HYDROXYBENZALDEHYDE[9 atoms]
A 100.0
/100.0
9
/9
R1A_SARS2 Papain-like protease nsp3
7ofu[1] B HE9
methyl 3,4-bis(oxidanyl)benzoate[12 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
7qcg[1] B DZI
3,4,5-tris(oxidanyl)-N-[(E)-1H-pyrrol-2-ylmethylid..
A 100.0
/100.0
7
/7
R1A_SARS2 Papain-like protease nsp3
7qch[1] B A5I
N-(3,5-dimetoxy-4-hydroxybenzyliden)thiosemicarbaz..
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-like protease nsp3
7qci[1] B A6Q
N-(3,4-dihydroxybenzylidene)-thiosemicarbazone[16 ..
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-like protease nsp3
7qcj[1] F A4O
N-(2,4-dihydroxybenzylidene)-thiosemicarbazone[14 ..
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-like protease nsp3
7qck[1] B A7L
N-(2,5-dihydroxybenzylidene)-thiosemicarbazone[16 ..
A 100.0
/100.0
9
/9
R1A_SARS2 Papain-like protease nsp3
7sdr[3] D JW9
4-({methyl[(1R)-1-(naphthalen-1-yl)ethyl]amino}met..
A 100.0
/100.0
12
/12
R1A_SARS2 Non-structural protein 3
7sgv[2] B L30
N-(naphthalen-1-yl)pyridine-3-carboxamide[19 atoms..
A 100.0
/99.7
9
/9
R1A_SARS2 Papain-like protease
8eua[1] B WUK
methyl 4-{2-[3-(2-{[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/100.0
18
/18
R1AB_SARS2 Papain-like protease nsp3
8g62[3] E YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli..
A 100.0
/100.0
10
/10
R1A_SARS2 Non-structural protein 3
8g62[1] F YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli..
A 100.0
/100.0
10
/10
R1A_SARS2 Non-structural protein 3
8g62[2] M YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli..
A 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
8gia[1] C ZJ3
[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihyd..
A 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 3
7e35[2] D GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen..
A 100.0
/99.7
11
/11
R1AB_SARS2 Non-structural protein 3
7e35[2] F GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen..
A 100.0
/99.7
7
/7
R1AB_SARS2 Non-structural protein 3
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7koj[1] B Y94
2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]-5-{[(pr..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7sgu[1] B 9EI
5-amino-N-(naphthalen-1-yl)pyridine-3-carboxamide[..
A 100.0
/99.7
8
/8
R1A_SARS2 Papain-like protease
7d7k[4] D CFF
CAFFEINE[14 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Non-structural protein 3
7d7l[2] E GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl)..
A 100.0
/99.7
9
/9
R1AB_SARS2 Non-structural protein 3
7d7l[2] F GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl)..
A 100.0
/99.7
4
/4
R1AB_SARS2 Non-structural protein 3
7d7l[1] R GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl)..
B 100.0
/99.7
4
/4
R1AB_SARS2 Non-structural protein 3
7m1y[2] C 9JT
N-phenyl-2-selanylbenzamide[16 atoms]
A 100.0
/99.7
7
/7
R1A_SARS2 Papain-like protease
7rzc[6] D JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha..
A 100.0
/100.0
10
/10
R1A_SARS2 Non-structural protein 3
7jn2[2] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/100.0
9
/9
R1A_SARS2 Papain-like protease
4ow0[2] D S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
A 100.0
/82.6
10
/10
R1A_CVHSA papain-like protease
7tzj[2] C S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
A 100.0
/99.7
10
/10
R1A_SARS2 Papain-like protease
7ybg[1] C MLA
MALONIC ACID[7 atoms]
A 83.3
/99.1
6
/6
R1A_SARS2 Papain-like protease nsp3
4m0w[1] E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 85.7
/82.3
7
/7
R1A_CVHSA Replicase polyprotein 1a
4m0w[1] F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 83.3
/82.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
3e9s[2] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/82.7
10
/10
R1A_CVHSA Non-structural protein 3
7cjm[7] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/99.7
10
/10
R1AB_SARS2 Non-structural protein 3
7skq[2] E TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/82.1
10
/10
Q0QDZ2_SARS 3C-like proteinase
7skr[2] B 9OZ
N-[(2-methoxypyridin-4-yl)methyl]-2-[(1R)-1-(napht..
A 100.0
/82.1
10
/10
Q0QDZ2_SARS 3C-like proteinase
3mj5[2] C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/82.7
9
/9
R1A_CVHSA Replicase polyprotein 1a
3mj5[2] E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/82.7
4
/4
R1A_CVHSA Replicase polyprotein 1a
4ovz[2] D P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
A 100.0
/82.5
11
/11
R1A_CVHSA Papain-like proteinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2fe8[124] D ZN
ZINC ION[1 atoms]
A 100.0
/82.8
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
6w9c[4] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
7cjm[1] C ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1AB_SARS2 Non-structural protein 3
7cjm[1] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7cmd[1] J ZN
ZINC ION[1 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
7cmd[2] K ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
7cmd[1] L ZN
ZINC ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
7d6h[5] B ZN
ZINC ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7jir[9] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7jir[11] E ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7jir[11] F ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7jiw[7] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease
7skq[2] D ZN
ZINC ION[1 atoms]
A 100.0
/82.1
3
/3
Q0QDZ2_SARS 3C-like proteinase
7tzj[2] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7tzj[1] K ZN
ZINC ION[1 atoms]
B 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
8eua[1] D ZN
ZINC ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Papain-like protease nsp3
2fe8[6] E BR
BROMIDE ION[1 atoms]
A 75.0
/82.8
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] F BR
BROMIDE ION[1 atoms]
A 100.0
/82.8
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] G BR
BROMIDE ION[1 atoms]
A 100.0
/82.8
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
8cx9[1] N BR
BROMIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
8cx9[1] P BR
BROMIDE ION[1 atoms]
B 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
8cx9[1] Q BR
BROMIDE ION[1 atoms]
B 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
8cx9[1] V BR
BROMIDE ION[1 atoms]
D 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
4m0w[2] D NA
SODIUM ION[1 atoms]
A 20.0
/82.3
5
/5
R1A_CVHSA Replicase polyprotein 1a
4ovz[3] H NA
SODIUM ION[1 atoms]
B 100.0
/81.3
5
/5
R1A_CVHSA Papain-like proteinase
5y3e[2] D NA
SODIUM ION[1 atoms]
A 40.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] E NA
SODIUM ION[1 atoms]
A 83.3
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
5y3e[4] F NA
SODIUM ION[1 atoms]
A 100.0
/82.8
3
/3
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] G NA
SODIUM ION[1 atoms]
A 100.0
/82.8
7
/7
R1A_CVHSA Replicase polyprotein 1a
6z5t[6] D NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] K NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[2] Q NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[5] AA NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] Z NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] KA NA
SODIUM ION[1 atoms]
D 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
7ybg[1] F NA
SODIUM ION[1 atoms]
A 100.0
/99.1
4
/4
R1A_SARS2 Papain-like protease nsp3
8cx9[2] R NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
6wuu[1] K MG
MAGNESIUM ION[1 atoms]
B 100.0
/99.4
1
/1
R1AB_SARS2 Non-structural protein 3
6wuu[1] M MG
MAGNESIUM ION[1 atoms]
C 100.0
/99.7
1
/1
R1AB_SARS2 Non-structural protein 3
6wuu[1] O MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
5
/5
R1AB_SARS2 Non-structural protein 3
6wuu[1] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
6ywk[4] I MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/4
R1AB_SARS2 NSP3 macrodomain
7bf5[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
7oft[1] L K
POTASSIUM ION[1 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
7oft[1] M K
POTASSIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
7m1y[2] G IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7m1y[2] H IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7m1y[2] I IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7m1y[2] J IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7m1y[2] K IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7m1y[2] L IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7m1y[1] Y IOD
IODIDE ION[1 atoms]
B 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7jn2[19] M UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease
7koj[11] M UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7d47[1] D CA
CALCIUM ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Non-structural protein 3
7d47[1] F CA
CALCIUM ION[1 atoms]
B 75.0
/99.7
4
/4
R1A_SARS2 Non-structural protein 3
8hbl[1] C LI
LITHIUM ION[1 atoms]
A 100.0
/99.2
4
/4
R1A_SARS2 Non-structural protein 3
7lfv[1] DA NH4
AMMONIUM ION[1 atoms]
B 100.0
/82.8
2
/2
R1A_SARS papain-like protease
5e6j[1] H NI
NICKEL (II) ION[1 atoms]
A 0.0
/82.0
2
/2
R1AB_CVHSA Replicase polyprotein 1ab
3e9s[28] D CL
CHLORIDE ION[1 atoms]
A 100.0
/82.7
2
/2
R1A_CVHSA Non-structural protein 3
3e9s[4] E CL
CHLORIDE ION[1 atoms]
A 75.0
/82.7
4
/4
R1A_CVHSA Non-structural protein 3
6w9c[12] E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
7
/7
R1A_SARS2 Non-structural protein 3
6wen[1] B CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6wrh[16] G CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
7jir[20] H CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7jir[5] J CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7lfv[1] FA CL
CHLORIDE ION[1 atoms]
B 100.0
/82.8
1
/1
R1A_SARS papain-like protease
7los[3] M CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
1
/1
R1A_SARS2 Non-structural protein 3
7m1y[2] E CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7nfv[4] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Papain-like protease nsp3
7oft[1] E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
7oft[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
7oft[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Papain-like protease nsp3
7oft[2] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
7oft[1] J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
7qcj[4] L CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
7qcj[1] N CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
7qcm[1] J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
7sqe[1] S CL
CHLORIDE ION[1 atoms]
C 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
8cx9[1] W CL
CHLORIDE ION[1 atoms]
D 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
8fwo[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Papain-like protease nsp3
8ilc[1] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
8ilc[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
8ufl[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/75.3
1
/1
R1A_SARS Papain-like protease nsp3
8ufl[1] E CL
CHLORIDE ION[1 atoms]
A 0.0
/75.3
1
/1
R1A_SARS Papain-like protease nsp3
8ufl[1] F CL
CHLORIDE ION[1 atoms]
A 50.0
/75.3
2
/2
R1A_SARS Papain-like protease nsp3
8ufl[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/75.3
1
/1
R1A_SARS Papain-like protease nsp3
8ufl[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/75.3
2
/2
R1A_SARS Papain-like protease nsp3
8ufl[1] J CL
CHLORIDE ION[1 atoms]
A 0.0
/75.3
1
/1
R1A_SARS Papain-like protease nsp3
8ufl[1] Q CL
CHLORIDE ION[1 atoms]
B 50.0
/75.4
2
/2
R1A_SARS Papain-like protease nsp3
8ufl[1] S CL
CHLORIDE ION[1 atoms]
B 0.0
/75.4
1
/1
R1A_SARS Papain-like protease nsp3
8ufl[1] T CL
CHLORIDE ION[1 atoms]
B 0.0
/75.4
1
/1
R1A_SARS Papain-like protease nsp3
8ufl[1] V CL
CHLORIDE ION[1 atoms]
B 100.0
/75.4
2
/2
R1A_SARS Papain-like protease nsp3
8ufl[1] W CL
CHLORIDE ION[1 atoms]
B 100.0
/75.4
1
/1
R1A_SARS Papain-like protease nsp3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w9c[18] B R1A_SARS2 Non-structural protein 3[307 aa] A 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
6xg3[2] A R1AB_SARS2 Non-structural protein 3[313 aa] A 100.0
/99.7
24
/24
R1AB_SARS2 Non-structural protein 3
7cjd[2] D R1AB_SARS2 Non-structural protein 3[310 aa] A 100.0
/99.7
14
/14
R1AB_SARS2 Non-structural protein 3
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 87.0
/82.8
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 75.0
/82.8
8
/9
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[8] C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] A 77.8
/82.8
18
/18
R1AB_CVHSA Replicase polyprotein 1ab
7skq[2] B Q0QDZ2_SARS 3C-like proteinase[304 aa] A 90.0
/82.1
20
/20
Q0QDZ2_SARS 3C-like proteinase
7skr[2] A Q0QDZ2_SARS 3C-like proteinase[314 aa] A 85.2
/82.1
27
/27
Q0QDZ2_SARS 3C-like proteinase
2w2g[6] B R1A_CVHSA NON-STRUCTURAL PROTEIN 3[256 aa] A 78.3
/76.3
23
/23
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5s49[1] F 3TR
3-AMINO-1,2,4-TRIAZOLE[6 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5s74[142] E EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
6ywk[3] L EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/3
R1AB_SARS2 NSP3 macrodomain
6ywk[1] W EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6ywk[1] Z EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6ywl[7] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6ywm[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
6z6i[2] IA EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6z72[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
7cjd[1] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/99.7
1
/1
R1AB_SARS2 Non-structural protein 3
7d7k[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7d7k[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7lfv[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/82.7
4
/4
R1A_SARS papain-like protease
7lfv[2] O EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/82.7
4
/4
R1A_SARS papain-like protease
7lfv[2] P EDO
1,2-ETHANEDIOL[4 atoms]
A 57.1
/82.7
7
/7
R1A_SARS papain-like protease
7lfv[1] BA EDO
1,2-ETHANEDIOL[4 atoms]
B 75.0
/82.8
4
/4
R1A_SARS papain-like protease
7nt4[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
7nt4[1] P EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
7nt4[1] R EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
7rzc[2] O EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
7uv5[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.4
5
/5
R1A_SARS2 Papain-like protease nsp3
6ywk[2] J EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
C 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6ywk[1] CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
11
/11
R1AB_SARS2 NSP3 macrodomain
6ywm[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 NSP3 macrodomain
7jir[5] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7jiw[2] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Papain-like protease
7lbs[2] F BO3
BORIC ACID[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
7lbs[2] G BO3
BORIC ACID[4 atoms]
A 100.0
/100.0
7
/7
R1A_SARS2 Non-structural protein 3
7lbs[1] I BO3
BORIC ACID[4 atoms]
A 100.0
/100.0
10
/10
R1A_SARS2 Non-structural protein 3
7lbs[1] O BO3
BORIC ACID[4 atoms]
B 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
4ovz[3] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/82.5
4
/4
R1A_CVHSA Papain-like proteinase
4ovz[1] I DMS
DIMETHYL SULFOXIDE[4 atoms]
B 33.3
/81.3
3
/3
R1A_CVHSA Papain-like proteinase
4ovz[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/81.3
3
/3
R1A_CVHSA Papain-like proteinase
4ovz[1] L DMS
DIMETHYL SULFOXIDE[4 atoms]
B 66.7
/81.3
6
/6
R1A_CVHSA Papain-like proteinase
4ow0[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 60.0
/82.6
5
/5
R1A_CVHSA papain-like protease
4ow0[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 50.0
/81.1
2
/2
R1A_CVHSA papain-like protease
5s18[3] E DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5s4a[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
7skr[2] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/82.1
2
/2
Q0QDZ2_SARS 3C-like proteinase
7tzj[2] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/99.7
5
/5
R1A_SARS2 Papain-like protease
4m0w[4] G GOL
GLYCEROL[6 atoms]
A 100.0
/82.3
5
/5
R1A_CVHSA Replicase polyprotein 1a
4m0w[4] H GOL
GLYCEROL[6 atoms]
A 66.7
/82.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
4ow0[1] F GOL
GLYCEROL[6 atoms]
A 66.7
/82.6
3
/3
R1A_CVHSA papain-like protease
5y3e[4] I GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
5y3e[1] J GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
6wrh[14] H GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Non-structural protein 3
6wrh[4] I GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
6xa9[5] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6xa9[2] H GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6xa9[1] P GOL
GLYCEROL[6 atoms]
E 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
6z6i[1] H GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[4] N GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[2] S GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
7d7l[1] L GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
5
/5
R1AB_SARS2 Non-structural protein 3
7lbr[1] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Non-structural protein 3
7lbr[2] L GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
7lbs[1] M GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
6
/6
R1A_SARS2 Non-structural protein 3
7nfv[2] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Papain-like protease nsp3
7ofu[8] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
7
/7
R1A_SARS2 Papain-like protease nsp3
7qcg[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
7qcj[2] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease nsp3
8f2e[2] B GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease nsp3
8f2e[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease nsp3
8f2e[1] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Papain-like protease nsp3
8f2e[1] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Papain-like protease nsp3
8hbl[1] D GOL
GLYCEROL[6 atoms]
A 100.0
/99.2
3
/3
R1A_SARS2 Non-structural protein 3
8hbl[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/99.2
4
/4
R1A_SARS2 Non-structural protein 3
8hbl[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/99.2
3
/3
R1A_SARS2 Non-structural protein 3
8hbl[1] G GOL
GLYCEROL[6 atoms]
A 100.0
/99.2
2
/2
R1A_SARS2 Non-structural protein 3
6wrh[3] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
6wrh[3] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
6wrh[2] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
5
/5
R1AB_SARS2 Non-structural protein 3
7d6h[1] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1A_SARS2 Papain-like protease
7nfv[11] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1A_SARS2 Papain-like protease nsp3
7ofu[3] G PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1A_SARS2 Papain-like protease nsp3
7ofu[3] H PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
7ofu[6] I PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
7qch[3] G PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
7qci[1] I PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
7qcj[2] J PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
7qcj[1] K PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Papain-like protease nsp3
8fwn[1] B PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1AB_SARS2 Papain-like protease nsp3
8hbl[1] B PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.2
3
/3
R1A_SARS2 Non-structural protein 3
2fe8[17] H SO4
SULFATE ION[5 atoms]
A 100.0
/82.8
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2w2g[4] C SO4
SULFATE ION[5 atoms]
A 33.3
/76.3
3
/3
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
5s4g[1] E SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5tl6[3] F SO4
SULFATE ION[5 atoms]
A 100.0
/82.9
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
7d7k[4] L SO4
SULFATE ION[5 atoms]
A 100.0
/99.7
5
/5
R1AB_SARS2 Non-structural protein 3
7d7k[5] M SO4
SULFATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7d7k[2] N SO4
SULFATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7d7k[1] W SO4
SULFATE ION[5 atoms]
B 100.0
/99.7
3
/3
R1AB_SARS2 Non-structural protein 3
7d7l[1] J SO4
SULFATE ION[5 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Non-structural protein 3
7d7l[1] K SO4
SULFATE ION[5 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Non-structural protein 3
7d7l[1] V SO4
SULFATE ION[5 atoms]
B 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7jrn[1] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
7jrn[4] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
7jrn[11] I SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
R1A_SARS2 Non-structural protein 3
7jrn[2] J SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
7lbs[1] H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
7llf[2] H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Non-structural protein 3
7llz[3] L SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
7nt4[1] K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
7nt4[2] T SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
7nt4[2] U SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
8ilc[1] B SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Papain-like protease nsp3
8ilc[1] C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Papain-like protease nsp3
8ilc[1] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease nsp3
8ufl[2] L SO4
SULFATE ION[5 atoms]
A 75.0
/75.3
4
/4
R1A_SARS Papain-like protease nsp3
8ufl[1] O SO4
SULFATE ION[5 atoms]
A 33.3
/75.3
3
/3
R1A_SARS Papain-like protease nsp3
8ufl[2] P SO4
SULFATE ION[5 atoms]
A 50.0
/75.3
2
/2
R1A_SARS Papain-like protease nsp3
8ufl[3] AA SO4
SULFATE ION[5 atoms]
B 100.0
/75.4
1
/1
R1A_SARS Papain-like protease nsp3
8ufl[1] Y SO4
SULFATE ION[5 atoms]
B 50.0
/75.4
2
/2
R1A_SARS Papain-like protease nsp3
8ufm[1] D SO4
SULFATE ION[5 atoms]
A 100.0
/99.2
3
/3
R1A_SARS2 Papain-like protease nsp3
8ufm[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/99.2
2
/2
R1A_SARS2 Papain-like protease nsp3
8ufm[1] G SO4
SULFATE ION[5 atoms]
A 100.0
/99.2
4
/4
R1A_SARS2 Papain-like protease nsp3
8ufm[1] H SO4
SULFATE ION[5 atoms]
A 100.0
/99.2
5
/5
R1A_SARS2 Papain-like protease nsp3
8ufm[1] J SO4
SULFATE ION[5 atoms]
A 100.0
/99.2
3
/3
R1A_SARS2 Papain-like protease nsp3
5e6j[1] G ACT
ACETATE ION[4 atoms]
A 83.3
/82.0
6
/6
R1AB_CVHSA Replicase polyprotein 1ab
7jir[6] L ACT
ACETATE ION[4 atoms]
A 85.7
/99.7
7
/7
R1A_SARS2 Papain-like protease
7jit[3] L ACT
ACETATE ION[4 atoms]
A 100.0
/99.7
5
/5
R1A_SARS2 Papain-like protease
7jn2[2] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease
8fwn[1] G ACT
ACETATE ION[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Papain-like protease nsp3
8g62[3] J ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Non-structural protein 3
8g62[2] K ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Non-structural protein 3
8g62[1] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
7m1y[1] M FMT
FORMIC ACID[3 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7m1y[2] N FMT
FORMIC ACID[3 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7m1y[1] O FMT
FORMIC ACID[3 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7m1y[1] BA FMT
FORMIC ACID[3 atoms]
B 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7sgu[1] G FMT
FORMIC ACID[3 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
8ufm[1] B FMT
FORMIC ACID[3 atoms]
A 100.0
/99.2
3
/3
R1A_SARS2 Papain-like protease nsp3
7ybg[1] B DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 100.0
/99.1
9
/9
R1A_SARS2 Papain-like protease nsp3
5y3q[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.