#WARNING:no index is registered index "YP_009725299.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725299.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3547828 1945 500 YP_009725299.1()
QUERYSEQ 
APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAA
LQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVV
GPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSA
TLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY
GARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
KVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYC
NKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY
KENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKP
VETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNY
MPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDL
TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDE
VARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEA
ELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725299.1()]

1945
region name description
1-1945 DISORDER predicted by DISOPRED

MONOMER
1945
pdb_id a1 identity[%]2 description
8yax A 100.0 R1AB_SARS2 Papain-like protease nsp3
6z5t B 100.0 R1AB_SARS2 Replicase polyprotein 1ab 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5tl6[5] D ISG15_HUMAN Ubiquitin-like protein ISG15[78 aa] A 100.0
/82.9		 21
/21		 R1AB_CVHSA Replicase polyprotein 1ab
8cx9[8] G RL40_HUMAN Ubiquitin variant UbV.CV2.1[75 aa] A 100.0
/100.0		 12
/12		 R1A_SARS2 Papain-like protease nsp3
8iho[2] C covalent inhibitor[4 aa] A 100.0
/100.0		 18
/18		 R1A_SARS2 Papain-like protease nsp3
8iho[1] D covalent inhibitor[4 aa] A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
8yax[36] C R1AB_SARS2 Non-structural protein 4[371 aa] A 100.0
/100.0		 21
/21		 R1AB_SARS2 Papain-like protease nsp3
8yax[18] C R1AB_SARS2 Non-structural protein 4[371 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
8yax[18] C R1AB_SARS2 Non-structural protein 4[371 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 Papain-like protease nsp3
8yax[12] C R1AB_SARS2 Non-structural protein 4[371 aa] B 100.0
/100.0		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
7rbs[5] B ISG15_HUMAN Ubiquitin-like protein ISG15[157 aa] A 96.7
/99.7		 30
/30		 R1A_SARS2 Papain-like protease
6yva[1] B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 96.6
/99.6		 29
/29		 R1A_SARS2 Replicase polyprotein 1a
4m0w[7] B RS27A_BOVIN Ubiquitin[76 aa] A 88.5
/82.3		 26
/26		 R1A_CVHSA Replicase polyprotein 1a
5e6j[2] C UBB_HUMAN Polyubiquitin-B[75 aa] A 63.6
/82.0		 11
/11		 R1AB_CVHSA Replicase polyprotein 1ab
7uv5[1] C UBB_HUMAN Ubiquitin[41 aa] A 100.0
/99.4		 10
/10		 R1A_SARS2 Papain-like protease nsp3
6wuu[8] E VIR250[5 aa] A 100.0
/99.7		 18
/18		 R1AB_SARS2 Non-structural protein 3
5tl7[2] A ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] B 92.6
/82.9		 27
/27		 R1AB_CVHSA Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rvj[1] B 4JQ
6-amino-2H-chromen-2-one[12 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5rvk[1] B 2AK
7-bromo-5-methyl-1H-indole-2,3-dione[13 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5rvl[1] B BVF
4-METHYLPYRIDIN-2-AMINE[8 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5rvm[1] B HBD
4-HYDROXYBENZAMIDE[10 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5rvn[1] B ANN
4-METHOXYBENZOIC ACID[11 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5rvo[1] B AQO
2-AMINOQUINAZOLIN-4(3H)-ONE[12 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5rvp[1] B 1SQ
ISOQUINOLIN-1-AMINE[11 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5rvq[1] B 4BY
5-methyl-1H-indole-2-carboxylic acid[13 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Non-structural protein 3
5rvr[1] B LZ1
1H-indazole[9 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 3
5rvs[1] B 0LO
5-phenylpyridine-3-carboxylic acid[15 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 3
5rvt[1] B 4BL
6-methyl-1H-indole-2-carboxylic acid[13 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5rvu[1] B 6P3
6-phenylpyridine-3-carboxylic acid[15 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Non-structural protein 3
5rvv[1] B WB1
6-methyl-1H-indole-3-carboxylic acid[13 atoms] 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Non-structural protein 3
5s2d[1] C U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-.. 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5s2h[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta.. 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 3
5s2i[1] C LUY
~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine[18.. 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 3
5s2j[1] C JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[.. 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5s2l[1] D VZS
N-(2-methoxy-5-methylphenyl)-N'-4H-1,2,4-triazol-4.. 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5s2u[1] C VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 3
5s2v[1] C W0G
(3R)-1-(2-fluorophenyl)-3-(methylamino)pyrrolidin-.. 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 3
5s2x[1] C W0J
(3R)-N-methyl-1-(pyridazin-3-yl)piperidin-3-amine[.. 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5s2y[1] C W0M
(2R)-2-(4-chlorophenoxy)propanamide[13 atoms] 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5s31[1] C W0S
1-(3,4,5-trimethoxyphenyl)methanamine[14 atoms] 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5s36[1] D 7ZC
1-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-methanami.. 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5s3i[1] C W1P
5-methyl-2-phenyl-2,4-dihydro-3H-pyrazol-3-one[13 .. 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5s3q[1] D W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 3
5s3q[1] E W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 3
5s3r[1] C W24
(2S,3S)-N,2-dimethyl-1-(methylsulfonyl)piperidine-.. 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5s3t[1] E W2G
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxylic.. 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5s3v[1] C W2M
(2R)-1',4'-dihydro-2'H-spiro[pyrrolidine-2,3'-quin.. 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
5s3w[1] C W2S
(3R,4R)-4-(2-methylphenyl)oxolane-3-carboxylic aci.. 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
5s3y[1] C W2Y
(2S,3S)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 3
5s4k[1] C W44
(2S,5R,6R)-7-methyl-2,3,4,5,6,7-hexahydro-1H-2,6-m.. 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
6w6y[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Non-structural protein 3
6woj[15] E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] 		A 100.0
/100.0		 21
/21		 R1AB_SARS2 Non-structural protein 3
6z6i[5] E A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. 		A 100.0
/100.0		 22
/22		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] X A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. 		C 100.0
/100.0		 5
/5		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] O MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
8azc[2] C MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
6z72[4] E A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m.. 		A 100.0
/100.0		 23
/23		 R1AB_SARS2 Replicase polyprotein 1ab
6z72[1] R MLT
D-MALATE[9 atoms] 		D 100.0
/100.0		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
7bf3[2] I ADN
ADENOSINE[19 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 NSP3 macrodomain
7bf4[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 NSP3 macrodomain
7bf5[4] G A2R
[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY.. 		A 100.0
/100.0		 23
/23		 R1AB_SARS2 NSP3 macrodomain
7bf6[4] D U08
(2~{R},3~{R},4~{S},5~{R})-2-(4-azanylpyrrolo[2,1-f.. 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 Papain-like protease nsp3
7gzw[1] B A1AK4
(3M)-3-(4-{[(1S)-1-(1,1-dioxo-1,2,3,4-tetrahydro-1.. 		A 100.0
/100.0		 18
/18		 R1AB_SARS2 Papain-like protease nsp3
7h01[1] B A1ALR
7-[(1S)-2-methyl-1-{[(6M)-6-(1-methyl-1H-pyrazol-4.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h09[2] C A1AL6
(4M)-1-methyl-4-(4-{[(1R)-2-methyl-1-(3-oxo-3,4-di.. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
7h0a[4] C A1AL7
2-[(4P)-4-(4-{[(1S)-1-(2,3-dihydro-1,4-benzodioxin.. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
7h0b[1] C A1AMD
(4M)-4-(4-{[(1R)-1-(2,3-dihydro[1,4]dioxino[2,3-b].. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
7h0c[1] C A1AME
4-{[(1R)-1-(1,1-dioxo-1,2,3,4-tetrahydro-1lambda~6.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0d[1] B A1AIP
7-[(1S)-1-{[(6P)-6-(1,3-dimethyl-1H-pyrazol-4-yl)-.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0e[2] C A1AMF
4-{[(1R)-1-(1,1-dioxo-1,2,3,4-tetrahydro-1lambda~6.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 Papain-like protease nsp3
7h0f[1] C A1AMG
N-cyclopropyl-4-{[(1R)-1-(1,1-dioxo-1,2,3,4-tetrah.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 Papain-like protease nsp3
7h0g[2] C A1AMI
(4S)-6-{(1S)-1-[(6,7-dihydro-5H-pyrrolo[2,3-d]pyri.. 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 Papain-like protease nsp3
7h0h[2] C A1AMJ
N-ethyl-4-{[(1S)-2-methyl-1-(3-methyl-4-oxo-3,4-di.. 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 Papain-like protease nsp3
7h0i[1] B A1AMK
4-{[(1R)-1-(4,4-dioxo-3,4-dihydro-2H-1,4lambda~6~-.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0j[2] C A1AML
6-{(1S)-2-methyl-1-[(7H-pyrrolo[2,3-d]pyrimidin-4-.. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
7h0k[1] B A1AMP
4-{[(1S)-1-(1,1-dioxo-1,2,3,4-tetrahydro-1lambda~6.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0l[1] C A1AMQ
4-{[(S)-cyclopropyl(1,1-dioxo-1,2,3,4-tetrahydro-1.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0m[2] C A1AMR
2-[(4P)-4-(4-{[(1S)-1-(1,1-dioxo-1,2,3,4-tetrahydr.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 Papain-like protease nsp3
7h0n[2] C A1AMS
7-[(1R)-1-({(6M)-6-[(4R)-imidazo[1,5-a]pyridin-6-y.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0q[1] C A1AMV
4-{[(1S)-1-(2-aminopyridin-4-yl)-2-methylpropyl]am.. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
7h0r[1] B A1AMW
7-[(1R)-2-methyl-1-{[(6M)-6-(1-methyl-2-oxo-1,2-di.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0s[2] C A1ANI
4-{[(1S)-1-(2-acetamido-1,3-benzothiazol-6-yl)-2-m.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0w[1] B A1ANP
7-{(1R)-2-methyl-1-[(7H-pyrrolo[2,3-d]pyrimidin-4-.. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
7h0x[2] C A1ANQ
(4M)-1-methyl-4-(4-{[(1S)-2-methyl-1-(3-oxo-3,4-di.. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
7h0y[1] C A1ANR
4-{[(1S)-1-(1,1-dioxo-1,2,3,4-tetrahydro-1lambda~6.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h0z[1] B A1ANS
4-{[(1R)-1-(1,1-dioxo-1,2,3,4-tetrahydro-1lambda~6.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h10[1] B A1ANV
7-[(1R)-1-{[6-(methanesulfonyl)-7H-pyrrolo[2,3-d]p.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 Papain-like protease nsp3
7h11[1] B A1ANW
7-[(1R)-1-{[(6M)-6-(2,5-dihydrofuran-3-yl)-7H-pyrr.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h12[1] B A1ANX
7-[(1R)-2-methyl-1-{[(6M)-6-(1H-pyrazol-4-yl)-7H-p.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h13[1] B A1ANU
7-[(1R)-1-{[(6M)-6-(3,3-dimethyl-2-oxo-2,3-dihydro.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h14[1] B A1ANY
7-[(1R)-2-methyl-1-{[(6M)-6-(1-methyl-6-oxo-1,6-di.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h15[1] B A1ANZ
7-[(1R)-1-{[(6M)-6-{2-[2-(dimethylamino)ethoxy]pyr.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 Papain-like protease nsp3
7h16[1] B A1AN0
7-{(1R)-1-[(6-bromo-7H-pyrrolo[2,3-d]pyrimidin-4-y.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h17[1] B A1AN2
7-[(1R)-1-{[6-(2-aminopyrimidin-5-yl)-7H-pyrrolo[2.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h18[1] B A1AN3
7-[(1R)-1-({6-[2-(3-hydroxyazetidin-1-yl)pyrimidin.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 Papain-like protease nsp3
7h19[2] C A1AN4
4-{[(1S)-1-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-me.. 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 Papain-like protease nsp3
7h1c[1] B A1AOA
7-[(1S)-1-{[(5R,8S)-10-acetyl-6,7,8,9-tetrahydro-5.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7h1d[1] B A1AOB
4-{[(1R)-1-(1,1-dioxo-1,2,3,4-tetrahydro-1lambda~6.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 Papain-like protease nsp3
7jiv[2] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1.. 		A 100.0
/99.7		 11
/11		 R1A_SARS2 Papain-like protease
7kok[2] B Y96
5-[(E)-(hydroxyimino)methyl]-2-methyl-N-[(1R)-1-(n.. 		A 100.0
/99.7		 10
/10		 R1A_SARS2 Papain-like protease
7lbr[2] F XT7
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1S,3R.. 		A 100.0
/100.0		 11
/11		 R1A_SARS2 Non-structural protein 3
7lbs[2] C XR8
5-[(azetidin-3-yl)amino]-2-methyl-N-[(1R)-1-(3-{5-.. 		A 100.0
/100.0		 12
/12		 R1A_SARS2 Non-structural protein 3
7llf[2] I Y54
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1R,3S.. 		A 100.0
/100.0		 11
/11		 R1A_SARS2 Non-structural protein 3
7llz[2] C Y61
N-[(1R)-1-(3-{5-[(acetylamino)methyl]thiophen-2-yl.. 		A 100.0
/100.0		 11
/11		 R1A_SARS2 Non-structural protein 3
7los[2] E Y97
5-(azetidin-3-ylamino)-2-methyl-~{N}-[(1~{R})-1-[3.. 		A 100.0
/100.0		 11
/11		 R1A_SARS2 Non-structural protein 3
7nt4[4] C PRL
PROFLAVIN[16 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
7nt4[2] E PRL
PROFLAVIN[16 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
7ofs[1] E YRL
4-(2-hydroxyethyl)phenol[10 atoms] 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Papain-like protease nsp3
7oft[1] K HBA
P-HYDROXYBENZALDEHYDE[9 atoms] 		A 100.0
/100.0		 9
/9		 R1A_SARS2 Papain-like protease nsp3
7ofu[2] B HE9
methyl 3,4-bis(oxidanyl)benzoate[12 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
7ofu[2] B HE9
methyl 3,4-bis(oxidanyl)benzoate[12 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
7qcg[1] B DZI
3,4,5-tris(oxidanyl)-N-[(E)-1H-pyrrol-2-ylmethylid.. 		A 100.0
/100.0		 7
/7		 R1A_SARS2 Papain-like protease nsp3
7qch[1] B A5I
N-(3,5-dimetoxy-4-hydroxybenzyliden)thiosemicarbaz.. 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Papain-like protease nsp3
7qci[1] B A6Q
N-(3,4-dihydroxybenzylidene)-thiosemicarbazone[16 .. 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Papain-like protease nsp3
7qcj[1] F A4O
N-(2,4-dihydroxybenzylidene)-thiosemicarbazone[14 .. 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Papain-like protease nsp3
7qck[1] B A7L
N-(2,5-dihydroxybenzylidene)-thiosemicarbazone[16 .. 		A 100.0
/100.0		 9
/9		 R1A_SARS2 Papain-like protease nsp3
7sdr[3] D JW9
4-({methyl[(1R)-1-(naphthalen-1-yl)ethyl]amino}met.. 		A 100.0
/100.0		 12
/12		 R1A_SARS2 Non-structural protein 3
7sgv[2] B L30
N-(naphthalen-1-yl)pyridine-3-carboxamide[19 atoms.. 		A 100.0
/99.7		 9
/9		 R1A_SARS2 Papain-like protease
8azi[2] C OHR
2'-deoxyadenosine 5'-diphosphoribose [35 atoms] 		A 100.0
/100.0		 22
/22		 R1A_SARS2 Papain-like protease nsp3
8azl[2] C OI3
2'-deoxyadenosine 5'-fluoro-diphosphoribose [36 at.. 		A 100.0
/100.0		 23
/23		 R1A_SARS2 Papain-like protease nsp3
8azm[2] C OI6
8-bromoadenosine 5'-diphosphoribose [37 atoms] 		A 100.0
/100.0		 22
/22		 R1A_SARS2 Papain-like protease nsp3
8azo[2] C OIG
beta-ethyl-adenosine diphosphate[29 atoms] 		A 100.0
/100.0		 14
/14		 R1A_SARS2 Papain-like protease nsp3
8azp[2] C OH9
beta-methyl-adenosine diphosphate[28 atoms] 		A 100.0
/100.0		 17
/17		 R1A_SARS2 Papain-like protease nsp3
8eua[1] B WUK
methyl 4-{2-[3-(2-{[(1R)-1-(naphthalen-1-yl)ethyl].. 		A 100.0
/100.0		 18
/18		 R1AB_SARS2 Papain-like protease nsp3
8g62[3] E YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Non-structural protein 3
8g62[1] F YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Non-structural protein 3
8g62[2] M YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Non-structural protein 3
8gia[1] C ZJ3
[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihyd.. 		A 100.0
/100.0		 23
/23		 R1AB_SARS2 Non-structural protein 3
8uob[1] B XB5
5-[2-(dimethylamino)ethoxy]-N-{(1R)-1-[(3M,5P)-3-(.. 		A 100.0
/100.0		 13
/13		 R1A_SARS2 Papain-like protease nsp3
8uuf[1] B XWO
N-{(1R)-1-[(3M,5P)-3,5-bis(1-methyl-1H-pyrazol-4-y.. 		A 100.0
/100.0		 13
/13		 R1A_SARS2 Papain-like protease nsp3
8uug[1] B XXW
N-[(1R)-1-{(3M,5M)-3-[1-(difluoromethyl)-1H-pyrazo.. 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 Papain-like protease nsp3
8uuh[1] B XYI
5-[2-(dimethylamino)ethoxy]-2-methyl-N-[(1R)-1-{(3.. 		A 100.0
/100.0		 15
/15		 R1A_SARS2 Papain-like protease nsp3
8uuu[1] B XYR
N-{(1R)-1-[(3P,5M)-3-[1-(difluoromethyl)-1H-pyrazo.. 		A 100.0
/100.0		 15
/15		 R1A_SARS2 Papain-like protease nsp3
8uuv[1] B Y2I
N-{(1R)-1-[(3P,5P)-3-(1-cyclopropyl-1H-pyrazol-4-y.. 		A 100.0
/100.0		 15
/15		 R1A_SARS2 Papain-like protease nsp3
8uuw[1] B Y2N
5-[2-(dimethylamino)ethoxy]-2-methyl-N-{(1R)-1-[(3.. 		A 100.0
/100.0		 14
/14		 R1A_SARS2 Papain-like protease nsp3
8uvm[4] E Y3R
ethyl 4-oxo-4-(2-{3-[2-({(1S)-1-[(3P)-3-(thiophen-.. 		A 100.0
/100.0		 19
/19		 R1AB_SARS2 Papain-like protease nsp3
8z4w[4] E A1D7X
1-[4-[[[4-(isoquinolin-5-ylamino)-6-(methylamino)-.. 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Non-structural protein 3
9azx[1] E A1AH3
{(2R,3S,4R,5R)-5-[(8S)-4-aminopyrrolo[2,1-f][1,2,4.. 		B 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 3
9dnu[1] B A1BEG
2-methyl-5-[(1R,5S)-8-methyl-3,8-diazabicyclo[3.2... 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
9dnv[1] B A1BEH
2-methyl-5-[(1R,4S)-5-methyl-2,5-diazabicyclo[2.2... 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
9do1[1] B A1BF2
2-methyl-N-{(1R)-1-[(2M)-2-(1-methyl-1H-pyrazol-4-.. 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 Papain-like protease nsp3
9do3[1] B A1BEF
5-[(3S)-3,4-dimethylpiperazin-1-yl]-2-methyl-N-{(1.. 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 Papain-like protease nsp3
9do5[1] B A1BEE
5-[2-(dimethylamino)ethoxy]-N-{(1R)-1-[(2P)-2-{1-[.. 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
9doi[1] B A1BEL
2-methyl-N-{(1S)-1-[(2P)-2-(1-methyl-1H-pyrazol-4-.. 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
9brx[1] B A1ASL
(4R)-N-(2,4-dimethylphenyl)-7-methyl[1,2,4]triazol.. 		A 100.0
/99.7		 11
/11		 R1A_SARS2 Papain-like protease nsp3
7e35[2] D GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen.. 		A 100.0
/99.7		 11
/11		 R1AB_SARS2 Non-structural protein 3
7e35[2] F GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen.. 		A 100.0
/99.7		 7
/7		 R1AB_SARS2 Non-structural protein 3
8jux[2] D V00
~{N}-[(3-fluorophenyl)methyl]-1-[(1~{R})-1-(3-meth.. 		A 100.0
/99.7		 12
/12		 R1AB_SARS2 Non-structural protein 7
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(.. 		A 100.0
/99.7		 11
/11		 R1A_SARS2 Papain-like protease
8yx2[2] E A1LZ5
~{N}-[1-(1,2-dihydroacenaphthylen-5-yl)cyclopropyl.. 		A 100.0
/99.7		 11
/11		 R1AB_SARS2 Papain-like protease nsp3
7koj[1] B Y94
2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]-5-{[(pr.. 		A 100.0
/99.7		 11
/11		 R1A_SARS2 Papain-like protease
7sgu[1] B 9EI
5-amino-N-(naphthalen-1-yl)pyridine-3-carboxamide[.. 		A 100.0
/99.7		 8
/8		 R1A_SARS2 Papain-like protease
9csy[1] E TFA
trifluoroacetic acid[7 atoms] 		A 100.0
/99.7		 2
/2		 R1A_SARS2 Papain-like protease
7d7k[4] D CFF
CAFFEINE[14 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Non-structural protein 3
7d7l[2] E GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. 		A 100.0
/99.7		 9
/9		 R1AB_SARS2 Non-structural protein 3
7d7l[2] F GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Non-structural protein 3
7d7l[1] R GXU
1-(2-methoxyethyl)-2-methyl-3-(pyrazin-2-ylmethyl).. 		B 100.0
/99.7		 4
/4		 R1AB_SARS2 Non-structural protein 3
7m1y[2] C 9JT
N-phenyl-2-selanylbenzamide[16 atoms] 		A 100.0
/99.7		 7
/7		 R1A_SARS2 Papain-like protease
8yx5[2] C A1LZ8
5-[(1~{R},5~{S})-3,6-diazabicyclo[3.1.1]heptan-3-y.. 		A 100.0
/99.7		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
7rzc[6] D JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Non-structural protein 3
8yx4[1] B A1LZ6
2-methyl-~{N}-[1-(1-methyl-2-oxidanylidene-benzo[c.. 		A 100.0
/99.7		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
7jn2[2] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl].. 		A 100.0
/100.0		 9
/9		 R1A_SARS2 Papain-like protease
8yx3[2] C A1LZ7
~{N}-[1-(1,2-dihydroacenaphthylen-5-yl)cyclopropyl.. 		A 100.0
/99.7		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
4ow0[2] D S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. 		A 100.0
/82.6		 10
/10		 R1A_CVHSA papain-like protease
7tzj[2] C S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. 		A 100.0
/99.7		 10
/10		 R1A_SARS2 Papain-like protease
9csy[3] D A1AZ1
2-methyl-5-(4-methylpiperazin-1-yl)-N-{1-[(2P)-2-(.. 		A 100.0
/99.7		 14
/14		 R1A_SARS2 Papain-like protease
9brv[1] C A1ASK
N-[2-(dimethylamino)ethyl]-N'-(3-methylphenyl)thio.. 		A 100.0
/99.1		 8
/8		 R1AB_SARS2 Papain-like protease nsp3
9brv[1] E A1ASK
N-[2-(dimethylamino)ethyl]-N'-(3-methylphenyl)thio.. 		A 100.0
/99.1		 3
/3		 R1AB_SARS2 Papain-like protease nsp3
7ybg[1] C MLA
MALONIC ACID[7 atoms] 		A 83.3
/99.1		 6
/6		 R1A_SARS2 Papain-like protease nsp3
9brw[4] E A1ARL
N-(2-chlorophenyl)-1-methyl-1H-pyrazolo[3,4-d]pyri.. 		A 100.0
/99.4		 9
/9		 R1A_SARS2 Papain-like protease nsp3
8tv7[1] C VI1
(1R,2R)-2-{[3-(methoxycarbonyl)-4,5,6,7,8,9-hexahy.. 		A 100.0
/98.8		 14
/14		 R1AB_SARS2 Papain-like protease nsp3
4m0w[1] E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms.. 		A 85.7
/82.3		 7
/7		 R1A_CVHSA Replicase polyprotein 1a
4m0w[1] F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms.. 		A 83.3
/82.3		 6
/6		 R1A_CVHSA Replicase polyprotein 1a
3e9s[2] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. 		A 100.0
/82.7		 10
/10		 R1A_CVHSA Non-structural protein 3
7cjm[7] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. 		A 100.0
/99.7		 10
/10		 R1AB_SARS2 Non-structural protein 3
7skq[2] E TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. 		A 100.0
/82.1		 10
/10		 Q0QDZ2_SARS 3C-like proteinase
7skr[2] B 9OZ
N-[(2-methoxypyridin-4-yl)methyl]-2-[(1R)-1-(napht.. 		A 100.0
/82.1		 10
/10		 Q0QDZ2_SARS 3C-like proteinase
3mj5[2] C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale.. 		A 100.0
/82.7		 9
/9		 R1A_CVHSA Replicase polyprotein 1a
3mj5[2] E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale.. 		A 100.0
/82.7		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
4ovz[2] D P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-.. 		A 100.0
/82.5		 11
/11		 R1A_CVHSA Papain-like proteinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2fe8[171] D ZN
ZINC ION[1 atoms] 		A 100.0
/82.8		 4
/4		 R1AB_CVHSA Replicase polyprotein 1ab
6w9c[4] H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Non-structural protein 3
7cjm[1] C ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Non-structural protein 3
7cjm[25] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
7cmd[1] J ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
7cmd[2] K ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 3
7cmd[3] L ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 3
7jir[16] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
7jir[31] E ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 2
/2		 R1A_SARS2 Papain-like protease
7jir[24] F ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 2
/2		 R1A_SARS2 Papain-like protease
7tzj[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1A_SARS2 Papain-like protease
7tzj[5] K ZN
ZINC ION[1 atoms] 		B 100.0
/99.7		 1
/1		 R1A_SARS2 Papain-like protease
8eua[1] D ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
8uuy[1] F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
8uuy[7] J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
8yx4[1] F ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Papain-like protease nsp3
8yx5[2] E ZN
ZINC ION[1 atoms] 		A 80.0
/99.7		 5
/5		 R1AB_SARS2 Papain-like protease nsp3
9doi[1] K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
2fe8[6] E BR
BROMIDE ION[1 atoms] 		A 75.0
/82.8		 4
/4		 R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] F BR
BROMIDE ION[1 atoms] 		A 100.0
/82.8		 3
/3		 R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] G BR
BROMIDE ION[1 atoms] 		A 100.0
/82.8		 4
/4		 R1AB_CVHSA Replicase polyprotein 1ab
8cx9[1] N BR
BROMIDE ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8cx9[1] P BR
BROMIDE ION[1 atoms] 		B 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8cx9[1] Q BR
BROMIDE ION[1 atoms] 		B 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8cx9[1] V BR
BROMIDE ION[1 atoms] 		D 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
3e9s[40] D CL
CHLORIDE ION[1 atoms] 		A 100.0
/82.7		 2
/2		 R1A_CVHSA Non-structural protein 3
3e9s[14] E CL
CHLORIDE ION[1 atoms] 		A 75.0
/82.7		 4
/4		 R1A_CVHSA Non-structural protein 3
6w9c[18] E CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 7
/7		 R1A_SARS2 Non-structural protein 3
6wen[20] B CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 3
7jir[53] H CL
CHLORIDE ION[1 atoms] 		A 100.0
/99.7		 4
/4		 R1A_SARS2 Papain-like protease
7jir[8] J CL
CHLORIDE ION[1 atoms] 		A 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
7lfv[1] FA CL
CHLORIDE ION[1 atoms] 		B 100.0
/82.8		 1
/1		 R1A_SARS papain-like protease
7los[3] M CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 1
/1		 R1A_SARS2 Non-structural protein 3
7nfv[5] F CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Papain-like protease nsp3
7oft[1] E CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
7oft[1] F CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7oft[2] I CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7oft[1] J CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7qcj[4] L CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7qcj[1] N CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
7qcm[2] J CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7sqe[1] S CL
CHLORIDE ION[1 atoms] 		C 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
8cx9[1] W CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8fwo[1] H CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
8ilc[1] G CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
8ilc[1] H CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
8ufl[1] D CL
CHLORIDE ION[1 atoms] 		A 100.0
/75.3		 1
/1		 R1A_SARS Papain-like protease nsp3
8ufl[1] E CL
CHLORIDE ION[1 atoms] 		A 0.0
/75.3		 1
/1		 R1A_SARS Papain-like protease nsp3
8ufl[1] F CL
CHLORIDE ION[1 atoms] 		A 50.0
/75.3		 2
/2		 R1A_SARS Papain-like protease nsp3
8ufl[1] H CL
CHLORIDE ION[1 atoms] 		A 100.0
/75.3		 1
/1		 R1A_SARS Papain-like protease nsp3
8ufl[1] I CL
CHLORIDE ION[1 atoms] 		A 100.0
/75.3		 2
/2		 R1A_SARS Papain-like protease nsp3
8ufl[1] J CL
CHLORIDE ION[1 atoms] 		A 0.0
/75.3		 1
/1		 R1A_SARS Papain-like protease nsp3
8ufl[1] Q CL
CHLORIDE ION[1 atoms] 		B 50.0
/75.4		 2
/2		 R1A_SARS Papain-like protease nsp3
8ufl[1] S CL
CHLORIDE ION[1 atoms] 		B 0.0
/75.4		 1
/1		 R1A_SARS Papain-like protease nsp3
8ufl[1] T CL
CHLORIDE ION[1 atoms] 		B 0.0
/75.4		 1
/1		 R1A_SARS Papain-like protease nsp3
8ufl[1] V CL
CHLORIDE ION[1 atoms] 		B 100.0
/75.4		 2
/2		 R1A_SARS Papain-like protease nsp3
8uuf[1] I CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
8uuv[1] I CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
8uuw[1] K CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
9doi[2] E CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Papain-like protease nsp3
4m0w[2] D NA
SODIUM ION[1 atoms] 		A 20.0
/82.3		 5
/5		 R1A_CVHSA Replicase polyprotein 1a
4ovz[3] H NA
SODIUM ION[1 atoms] 		B 100.0
/81.3		 5
/5		 R1A_CVHSA Papain-like proteinase
5y3e[2] D NA
SODIUM ION[1 atoms] 		A 40.0
/82.8		 5
/5		 R1A_CVHSA Replicase polyprotein 1a
5y3e[2] E NA
SODIUM ION[1 atoms] 		A 83.3
/82.8		 6
/6		 R1A_CVHSA Replicase polyprotein 1a
5y3e[4] F NA
SODIUM ION[1 atoms] 		A 100.0
/82.8		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
5y3e[2] G NA
SODIUM ION[1 atoms] 		A 100.0
/82.8		 7
/7		 R1A_CVHSA Replicase polyprotein 1a
6z5t[6] D NA
SODIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] K NA
SODIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[2] Q NA
SODIUM ION[1 atoms] 		B 100.0
/100.0		 2
/2		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[5] AA NA
SODIUM ION[1 atoms] 		C 100.0
/100.0		 2
/2		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] Z NA
SODIUM ION[1 atoms] 		C 100.0
/100.0		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] KA NA
SODIUM ION[1 atoms] 		D 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
7ybg[1] F NA
SODIUM ION[1 atoms] 		A 100.0
/99.1		 4
/4		 R1A_SARS2 Papain-like protease nsp3
8cx9[2] R NA
SODIUM ION[1 atoms] 		B 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7oft[1] L K
POTASSIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
7oft[1] M K
POTASSIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
6wuu[1] K MG
MAGNESIUM ION[1 atoms] 		B 100.0
/99.4		 1
/1		 R1AB_SARS2 Non-structural protein 3
6wuu[1] M MG
MAGNESIUM ION[1 atoms] 		C 100.0
/99.7		 1
/1		 R1AB_SARS2 Non-structural protein 3
6wuu[1] O MG
MAGNESIUM ION[1 atoms] 		D 100.0
/99.7		 5
/5		 R1AB_SARS2 Non-structural protein 3
6wuu[1] P MG
MAGNESIUM ION[1 atoms] 		D 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
6ywk[4] I MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 1
/4		 R1AB_SARS2 NSP3 macrodomain
7bf5[1] F MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 NSP3 macrodomain
8jux[1] C MG
MAGNESIUM ION[1 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 7
7m1y[2] G IOD
IODIDE ION[1 atoms] 		A 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
7m1y[2] H IOD
IODIDE ION[1 atoms] 		A 100.0
/99.7		 4
/4		 R1A_SARS2 Papain-like protease
7m1y[2] I IOD
IODIDE ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1A_SARS2 Papain-like protease
7m1y[2] J IOD
IODIDE ION[1 atoms] 		A 100.0
/99.7		 4
/4		 R1A_SARS2 Papain-like protease
7m1y[2] K IOD
IODIDE ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1A_SARS2 Papain-like protease
7m1y[2] L IOD
IODIDE ION[1 atoms] 		A 100.0
/99.7		 2
/2		 R1A_SARS2 Papain-like protease
7m1y[1] Y IOD
IODIDE ION[1 atoms] 		B 100.0
/99.7		 1
/1		 R1A_SARS2 Papain-like protease
8yx4[1] G CD
CADMIUM ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
8yx4[1] H CD
CADMIUM ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
8yx4[1] I CD
CADMIUM ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
8yx4[1] J CD
CADMIUM ION[1 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
8yx4[2] K CD
CADMIUM ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Papain-like protease nsp3
7jn2[19] M UNX
UNKNOWN ATOM OR ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease
7koj[11] M UNX
UNKNOWN ATOM OR ION[1 atoms] 		A 100.0
/99.7		 2
/2		 R1A_SARS2 Papain-like protease
7d47[1] D CA
CALCIUM ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1A_SARS2 Non-structural protein 3
7d47[1] F CA
CALCIUM ION[1 atoms] 		B 75.0
/99.7		 4
/4		 R1A_SARS2 Non-structural protein 3
8hbl[1] C LI
LITHIUM ION[1 atoms] 		A 100.0
/99.2		 4
/4		 R1A_SARS2 Non-structural protein 3
7lfv[1] DA NH4
AMMONIUM ION[1 atoms] 		B 100.0
/82.8		 2
/2		 R1A_SARS papain-like protease
5e6j[1] H NI
NICKEL (II) ION[1 atoms] 		A 0.0
/82.0		 2
/2		 R1AB_CVHSA Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6w9c[20] B R1A_SARS2 Non-structural protein 3[307 aa] A 100.0
/100.0		 5
/5		 R1A_SARS2 Non-structural protein 3
6xg3[2] A R1AB_SARS2 Non-structural protein 3[313 aa] A 100.0
/99.7		 24
/24		 R1AB_SARS2 Non-structural protein 3
7cjd[2] D R1AB_SARS2 Non-structural protein 3[310 aa] A 100.0
/99.7		 14
/14		 R1AB_SARS2 Non-structural protein 3
7d6h[2] A R1A_SARS2 Papain-like protease[316 aa] A 100.0
/99.7		 23
/23		 R1A_SARS2 Papain-like protease
8azc[2] A R1A_SARS2 Papain-like protease nsp3[169 aa] A 100.0
/100.0		 6
/6		 R1A_SARS2 Papain-like protease nsp3
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] A 100.0
/100.0		 44
/44		 R1AB_SARS2 Papain-like protease nsp3
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] A 100.0
/100.0		 48
/48		 R1AB_SARS2 Papain-like protease nsp3
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] B 100.0
/100.0		 7
/7		 R1AB_SARS2 Papain-like protease nsp3
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] B 100.0
/100.0		 24
/24		 R1AB_SARS2 Papain-like protease nsp3
8yax[6] A R1AB_SARS2 Papain-like protease nsp3[1314 aa] B 100.0
/100.0		 17
/17		 R1AB_SARS2 Papain-like protease nsp3
8yax[6] B R1AB_SARS2 Papain-like protease nsp3[543 aa] A 100.0
/100.0		 9
/9		 R1AB_SARS2 Papain-like protease nsp3
8yax[6] B R1AB_SARS2 Papain-like protease nsp3[543 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 Papain-like protease nsp3
8yax[6] B R1AB_SARS2 Papain-like protease nsp3[543 aa] A 100.0
/100.0		 24
/24		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] A R1AB_SARS2 Papain-like protease nsp3[353 aa] A 100.0
/100.0		 9
/9		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] A R1AB_SARS2 Papain-like protease nsp3[353 aa] A 100.0
/100.0		 9
/9		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] B R1AB_SARS2 Papain-like protease nsp3[361 aa] A 100.0
/100.0		 9
/9		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] B R1AB_SARS2 Papain-like protease nsp3[361 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] B R1AB_SARS2 Papain-like protease nsp3[361 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] A R1AB_SARS2 Papain-like protease nsp3[353 aa] B 100.0
/100.0		 6
/6		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] A R1AB_SARS2 Papain-like protease nsp3[353 aa] B 100.0
/100.0		 13
/13		 R1AB_SARS2 Papain-like protease nsp3
8yb5[12] A R1AB_SARS2 Papain-like protease nsp3[353 aa] B 100.0
/100.0		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 87.0
/82.8		 23
/23		 R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 75.0
/82.8		 8
/9		 R1AB_CVHSA Replicase polyprotein 1ab
2fe8[8] C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] A 77.8
/82.8		 18
/18		 R1AB_CVHSA Replicase polyprotein 1ab
7skq[2] B Q0QDZ2_SARS 3C-like proteinase[304 aa] A 90.0
/82.1		 20
/20		 Q0QDZ2_SARS 3C-like proteinase
7skr[2] A Q0QDZ2_SARS 3C-like proteinase[314 aa] A 85.2
/82.1		 27
/27		 Q0QDZ2_SARS 3C-like proteinase
2w2g[6] B R1A_CVHSA NON-STRUCTURAL PROTEIN 3[256 aa] A 78.3
/76.3		 23
/23		 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4m0w[4] G GOL
GLYCEROL[6 atoms] 		A 100.0
/82.3		 5
/5		 R1A_CVHSA Replicase polyprotein 1a
4m0w[8] H GOL
GLYCEROL[6 atoms] 		A 66.7
/82.3		 6
/6		 R1A_CVHSA Replicase polyprotein 1a
4ow0[1] F GOL
GLYCEROL[6 atoms] 		A 66.7
/82.6		 3
/3		 R1A_CVHSA papain-like protease
5y3e[4] I GOL
GLYCEROL[6 atoms] 		A 100.0
/82.8		 6
/6		 R1A_CVHSA Replicase polyprotein 1a
5y3e[6] J GOL
GLYCEROL[6 atoms] 		A 100.0
/82.8		 5
/5		 R1A_CVHSA Replicase polyprotein 1a
6wrh[15] H GOL
GLYCEROL[6 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Non-structural protein 3
6xa9[5] G GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 3
6xa9[2] H GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 3
6xa9[1] P GOL
GLYCEROL[6 atoms] 		E 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 3
6z6i[1] H GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[4] N GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
6z6i[2] S GOL
GLYCEROL[6 atoms] 		C 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
7d7l[1] L GOL
GLYCEROL[6 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Non-structural protein 3
7lbr[4] G GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Non-structural protein 3
7lbr[2] L GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 4
/4		 R1A_SARS2 Non-structural protein 3
7lbs[2] M GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 6
/6		 R1A_SARS2 Non-structural protein 3
7nfv[2] C GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 6
/6		 R1A_SARS2 Papain-like protease nsp3
7ofu[9] D GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 7
/7		 R1A_SARS2 Papain-like protease nsp3
7qcg[1] C GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
7qcj[2] E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8f2e[2] B GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Papain-like protease nsp3
8f2e[1] C GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Papain-like protease nsp3
8f2e[1] D GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Papain-like protease nsp3
8f2e[1] G GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Papain-like protease nsp3
8hbl[1] D GOL
GLYCEROL[6 atoms] 		A 100.0
/99.2		 3
/3		 R1A_SARS2 Non-structural protein 3
8hbl[1] E GOL
GLYCEROL[6 atoms] 		A 100.0
/99.2		 4
/4		 R1A_SARS2 Non-structural protein 3
8hbl[1] F GOL
GLYCEROL[6 atoms] 		A 100.0
/99.2		 3
/3		 R1A_SARS2 Non-structural protein 3
8hbl[2] G GOL
GLYCEROL[6 atoms] 		A 100.0
/99.2		 2
/2		 R1A_SARS2 Non-structural protein 3
8tv7[1] B GOL
GLYCEROL[6 atoms] 		A 100.0
/98.8		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
8uuu[1] N GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8yx5[1] K GOL
GLYCEROL[6 atoms] 		B 100.0
/99.7		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
9do5[1] T GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
4ovz[3] E DMS
DIMETHYL SULFOXIDE[4 atoms] 		A 100.0
/82.5		 4
/4		 R1A_CVHSA Papain-like proteinase
4ovz[1] I DMS
DIMETHYL SULFOXIDE[4 atoms] 		B 33.3
/81.3		 3
/3		 R1A_CVHSA Papain-like proteinase
4ovz[1] J DMS
DIMETHYL SULFOXIDE[4 atoms] 		B 100.0
/81.3		 3
/3		 R1A_CVHSA Papain-like proteinase
4ovz[1] L DMS
DIMETHYL SULFOXIDE[4 atoms] 		B 66.7
/81.3		 6
/6		 R1A_CVHSA Papain-like proteinase
4ow0[1] G DMS
DIMETHYL SULFOXIDE[4 atoms] 		A 60.0
/82.6		 5
/5		 R1A_CVHSA papain-like protease
4ow0[1] J DMS
DIMETHYL SULFOXIDE[4 atoms] 		B 50.0
/81.1		 2
/2		 R1A_CVHSA papain-like protease
7skr[2] C DMS
DIMETHYL SULFOXIDE[4 atoms] 		A 100.0
/82.1		 2
/2		 Q0QDZ2_SARS 3C-like proteinase
7tzj[2] H DMS
DIMETHYL SULFOXIDE[4 atoms] 		A 100.0
/99.7		 5
/5		 R1A_SARS2 Papain-like protease
8uuw[1] C DMS
DIMETHYL SULFOXIDE[4 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
5e6j[1] G ACT
ACETATE ION[4 atoms] 		A 83.3
/82.0		 6
/6		 R1AB_CVHSA Replicase polyprotein 1ab
7jir[7] L ACT
ACETATE ION[4 atoms] 		A 85.7
/99.7		 7
/7		 R1A_SARS2 Papain-like protease
7jit[3] L ACT
ACETATE ION[4 atoms] 		A 100.0
/99.7		 5
/5		 R1A_SARS2 Papain-like protease
7jn2[2] L ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease
8fwn[1] G ACT
ACETATE ION[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
8g62[4] J ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Non-structural protein 3
8g62[2] K ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 6
/6		 R1A_SARS2 Non-structural protein 3
8g62[1] L ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Non-structural protein 3
8uuf[1] C ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
8uug[4] D ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Papain-like protease nsp3
9dnu[2] C ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Papain-like protease nsp3
6ywk[133] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 NSP3 macrodomain
6ywk[3] L EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 2
/3		 R1AB_SARS2 NSP3 macrodomain
6ywk[1] W EDO
1,2-ETHANEDIOL[4 atoms] 		D 100.0
/100.0		 1
/1		 R1AB_SARS2 NSP3 macrodomain
6ywk[1] Z EDO
1,2-ETHANEDIOL[4 atoms] 		D 100.0
/100.0		 1
/1		 R1AB_SARS2 NSP3 macrodomain
6ywl[7] H EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 NSP3 macrodomain
6ywm[1] I EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 NSP3 macrodomain
6z6i[2] IA EDO
1,2-ETHANEDIOL[4 atoms] 		D 100.0
/100.0		 1
/1		 R1AB_SARS2 Replicase polyprotein 1ab
6z72[1] G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
6z72[1] N EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
7cjd[1] G EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/99.7		 1
/1		 R1AB_SARS2 Non-structural protein 3
7d7k[1] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
7d7k[1] J EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
7lfv[1] H EDO
1,2-ETHANEDIOL[4 atoms] 		A 75.0
/82.7		 4
/4		 R1A_SARS papain-like protease
7lfv[2] O EDO
1,2-ETHANEDIOL[4 atoms] 		A 75.0
/82.7		 4
/4		 R1A_SARS papain-like protease
7lfv[2] P EDO
1,2-ETHANEDIOL[4 atoms] 		A 57.1
/82.7		 7
/7		 R1A_SARS papain-like protease
7lfv[1] BA EDO
1,2-ETHANEDIOL[4 atoms] 		B 75.0
/82.8		 4
/4		 R1A_SARS papain-like protease
7nt4[1] I EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 3
7nt4[1] P EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 3
7nt4[1] R EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 3
7rzc[2] O EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 5
/5		 R1A_SARS2 Non-structural protein 3
7uv5[1] G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.4		 5
/5		 R1A_SARS2 Papain-like protease nsp3
9do3[1] E EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Papain-like protease nsp3
9do3[1] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Papain-like protease nsp3
6ywk[2] J EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI.. 		C 100.0
/100.0		 6
/6		 R1AB_SARS2 NSP3 macrodomain
6ywk[1] CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI.. 		E 100.0
/100.0		 11
/11		 R1AB_SARS2 NSP3 macrodomain
6ywm[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 NSP3 macrodomain
7jir[5] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
7jiw[2] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 6
/6		 R1A_SARS2 Papain-like protease
7h0e[1] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Papain-like protease nsp3
7h0e[2] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 2
/2		 R1AB_SARS2 Papain-like protease nsp3
7h0g[1] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Papain-like protease nsp3
7h0g[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 2
/2		 R1AB_SARS2 Papain-like protease nsp3
8uuh[4] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8uuh[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 3
/3		 R1A_SARS2 Papain-like protease nsp3
7lbs[2] F BO3
BORIC ACID[4 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Non-structural protein 3
7lbs[2] G BO3
BORIC ACID[4 atoms] 		A 100.0
/100.0		 7
/7		 R1A_SARS2 Non-structural protein 3
7lbs[1] I BO3
BORIC ACID[4 atoms] 		A 100.0
/100.0		 10
/10		 R1A_SARS2 Non-structural protein 3
7lbs[1] O BO3
BORIC ACID[4 atoms] 		B 100.0
/100.0		 2
/2		 R1A_SARS2 Non-structural protein 3
8uuy[1] D PGE
TRIETHYLENE GLYCOL[10 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
9dnv[1] C ACY
ACETIC ACID[4 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Papain-like protease nsp3
2fe8[17] H SO4
SULFATE ION[5 atoms] 		A 100.0
/82.8		 4
/4		 R1AB_CVHSA Replicase polyprotein 1ab
2w2g[4] C SO4
SULFATE ION[5 atoms] 		A 33.3
/76.3		 3
/3		 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
5tl6[3] F SO4
SULFATE ION[5 atoms] 		A 100.0
/82.9		 3
/3		 R1AB_CVHSA Replicase polyprotein 1ab
7d7k[4] L SO4
SULFATE ION[5 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Non-structural protein 3
7d7k[7] M SO4
SULFATE ION[5 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
7d7k[2] N SO4
SULFATE ION[5 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
7d7k[1] W SO4
SULFATE ION[5 atoms] 		B 100.0
/99.7		 3
/3		 R1AB_SARS2 Non-structural protein 3
7d7l[1] J SO4
SULFATE ION[5 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Non-structural protein 3
7d7l[1] K SO4
SULFATE ION[5 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Non-structural protein 3
7d7l[1] V SO4
SULFATE ION[5 atoms] 		B 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
7jrn[1] E SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Non-structural protein 3
7jrn[4] F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Non-structural protein 3
7jrn[11] I SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 R1A_SARS2 Non-structural protein 3
7jrn[2] J SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 5
/5		 R1A_SARS2 Non-structural protein 3
7lbs[1] H SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Non-structural protein 3
7llf[2] H SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Non-structural protein 3
7llz[3] L SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 5
/5		 R1A_SARS2 Non-structural protein 3
7nt4[1] K SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 3
7nt4[2] T SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 3
7nt4[2] U SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 3
8ilc[1] B SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Papain-like protease nsp3
8ilc[1] C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
8ilc[1] D SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
8ufl[2] L SO4
SULFATE ION[5 atoms] 		A 75.0
/75.3		 4
/4		 R1A_SARS Papain-like protease nsp3
8ufl[1] O SO4
SULFATE ION[5 atoms] 		A 33.3
/75.3		 3
/3		 R1A_SARS Papain-like protease nsp3
8ufl[2] P SO4
SULFATE ION[5 atoms] 		A 50.0
/75.3		 2
/2		 R1A_SARS Papain-like protease nsp3
8ufl[3] AA SO4
SULFATE ION[5 atoms] 		B 100.0
/75.4		 1
/1		 R1A_SARS Papain-like protease nsp3
8ufl[1] Y SO4
SULFATE ION[5 atoms] 		B 50.0
/75.4		 2
/2		 R1A_SARS Papain-like protease nsp3
8ufm[1] D SO4
SULFATE ION[5 atoms] 		A 100.0
/99.2		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8ufm[1] F SO4
SULFATE ION[5 atoms] 		A 100.0
/99.2		 2
/2		 R1A_SARS2 Papain-like protease nsp3
8ufm[1] G SO4
SULFATE ION[5 atoms] 		A 100.0
/99.2		 4
/4		 R1A_SARS2 Papain-like protease nsp3
8ufm[2] H SO4
SULFATE ION[5 atoms] 		A 100.0
/99.2		 5
/5		 R1A_SARS2 Papain-like protease nsp3
8ufm[1] J SO4
SULFATE ION[5 atoms] 		A 100.0
/99.2		 3
/3		 R1A_SARS2 Papain-like protease nsp3
8uvm[4] F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Papain-like protease nsp3
6wrh[3] C PO4
PHOSPHATE ION[5 atoms] 		A 83.3
/99.7		 6
/6		 R1AB_SARS2 Non-structural protein 3
6wrh[3] D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Non-structural protein 3
6wrh[2] E PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Non-structural protein 3
7d6h[2] C PO4
PHOSPHATE ION[5 atoms] 		A 83.3
/99.7		 6
/6		 R1A_SARS2 Papain-like protease
7nfv[12] E PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 R1A_SARS2 Papain-like protease nsp3
7ofu[2] F PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
7ofu[4] G PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 R1A_SARS2 Papain-like protease nsp3
7ofu[4] G PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
7ofu[4] H PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7ofu[7] I PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
7qch[3] G PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 R1A_SARS2 Papain-like protease nsp3
7qci[1] I PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1A_SARS2 Papain-like protease nsp3
7qcj[1] K PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Papain-like protease nsp3
8fwn[1] B PO4
PHOSPHATE ION[5 atoms] 		A 83.3
/99.7		 6
/6		 R1AB_SARS2 Papain-like protease nsp3
8hbl[1] B PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/99.2		 3
/3		 R1A_SARS2 Non-structural protein 3
7m1y[1] M FMT
FORMIC ACID[3 atoms] 		A 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
7m1y[2] N FMT
FORMIC ACID[3 atoms] 		A 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
7m1y[1] O FMT
FORMIC ACID[3 atoms] 		A 100.0
/99.7		 4
/4		 R1A_SARS2 Papain-like protease
7m1y[1] BA FMT
FORMIC ACID[3 atoms] 		B 100.0
/99.7		 4
/4		 R1A_SARS2 Papain-like protease
7sgu[1] G FMT
FORMIC ACID[3 atoms] 		A 100.0
/99.7		 3
/3		 R1A_SARS2 Papain-like protease
8ufm[1] B FMT
FORMIC ACID[3 atoms] 		A 100.0
/99.2		 3
/3		 R1A_SARS2 Papain-like protease nsp3
7ybg[1] B DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] 		A 100.0
/99.1		 9
/9		 R1A_SARS2 Papain-like protease nsp3
5y3q[1] C BME
BETA-MERCAPTOETHANOL[4 atoms] 		A 100.0
/82.8		 6
/6		 R1A_CVHSA Replicase polyprotein 1a
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.