#WARNING:no index is registered index "YP_009725297.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725297.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1702901 180 28 YP_009725297.1()
QUERYSEQ 
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725297.1()]

180
region name description
1-180 DISORDER predicted by DISOPRED

MONOMER
180
pdb_id a1 identity[%]2 description
8aou A 100.0 R1AB_SARS2 Host translation inhibitor nsp1 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zlw[12] C RS2_HUMAN 40S ribosomal protein S2[218 aa] JA 100.0
/100.0		 8
/8		 R1AB_SARS2 Non-structural protein 1
7jqb[2] F uS5[221 aa] AA 100.0
/100.0		 8
/8		 R1AB_SARS2 Host translation inhibitor nsp1
6zlw[11] DA RS30_HUMAN 40S ribosomal protein S30[52 aa] JA 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 1
6zlw[11] E RS3_HUMAN 40S ribosomal protein S3[225 aa] JA 100.0
/100.0		 10
/10		 R1AB_SARS2 Non-structural protein 1
7jqb[2] H G1TNM3_RABIT Ribosomal protein S3[228 aa] AA 100.0
/100.0		 9
/9		 R1AB_SARS2 Host translation inhibitor nsp1
7jqb[2] I G1T8A2_RABIT eS30[57 aa] AA 100.0
/100.0		 4
/4		 R1AB_SARS2 Host translation inhibitor nsp1
7opl[1] A DPOLA_HUMAN DNA polymerase alpha catalytic subunit[1070 aa] E 85.7
/88.6		 14
/14		 R1A_SARS Non-structural protein 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zlw[2] IA 18S ribosomal RNA JA 100.0
/100.0		 8
/8		 R1AB_SARS2 Non-structural protein 1
6zm7[4] WA 18S ribosomal RNA HC 100.0
/100.0		 9
/9		 R1AB_SARS2 Non-structural protein 1
6zmt[1] GA 18S ribosomal RNA HA 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 1
6zn5[1] HA 18S ribosomal RNA IA 100.0
/100.0		 9
/9		 R1AB_SARS2 Non-structural protein 1
6zoj[1] A 18S ribosomal RNA IA 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 1
6zok[1] A 18S ribosomal RNA U 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 1
6zon[2] T 18S ribosomal RNA VA 100.0
/100.0		 8
/8		 R1AB_SARS2 Host translation inhibitor Nsp1
7jqb[2] A rRNA AA 100.0
/100.0		 7
/7		 R1AB_SARS2 Host translation inhibitor nsp1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8a4y[1] B QO6
N-(2,3-dihydro-1H-inden-5-yl)acetamide[13 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Host translation inhibitor nsp1
8asq[1] B NT9
~{N}-methyl-1-(4-thiophen-2-ylphenyl)methanamine[1.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Host translation inhibitor nsp1
8ays[1] B 92G
4-(2-amino-1,3-thiazol-4-yl)phenol[13 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Host translation inhibitor nsp1
8ayw[1] B OG3
(1~{R})-1-(4-chlorophenyl)ethanamine[10 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Host translation inhibitor nsp1
8az8[1] B OEI
2-[(phenylmethyl)amino]ethanol[11 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Host translation inhibitor nsp1
8az9[1] B OF6
1-[2-(3-chlorophenyl)-1,3-thiazol-4-yl]-~{N}-methy.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Host translation inhibitor nsp1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
180 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k5i[1] KA MG
MAGNESIUM ION[1 atoms] 		JA 100.0
/100.0		 1
/1		 R1AB_SARS2 Host translation inhibitor nsp1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.