Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
| PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
| 634691 | 886 | 4 | Q96JC1(VPS39_HUMAN) | RecName: Full=Vam6/Vps39-like protein ;AltName: Full=TRAP1-like protein; Short=hVam6p; |
| QUERYSEQ |
MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCNRFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLFTCDLQHTETGEEVLRMCVAVKKKLQLYFWK DREFHELQGDFSVPDVPKSMAWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIELQRPRFITSGGSNIIYVASN HFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPVLSGAELEKAHLALIDYLTQKRSQLVKKLNDSDHQSSTSPLMEGTPTI KSKKKLLQIIDTTLLKCYLHTNVALVAPLLRLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLGFLIENFKGLA IPYLEHIIHVWEETGSRFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEYRQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAEEYCHKHYDRNKDGNKDVYLSLLRMYLSPPS IHCLGPIKLELLEPKANLQAALQVLELHHSKLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNPADT |
|||
| 886 |
|
region | name | description |
|
|
1-886 | CHAIN | /note="Vam6/Vps39-like protein" /id="PRO_0000065901" |
|
|
15-294 | DOMAIN | /note="CNH" |
|
|
573-750 | REPEAT | /note="CHCR" |
|
|
1-886 | DISORDER | predicted by DISOPRED |
MONOMER |
|||||||
| 886 | |||||||
|
|
pdb_id | a1 | identity[%]2 | description | |||
|
|
6ze9 |
A | 100.0 | VPS39_HUMAN Vam6/Vps39-like protein | |||
|
|
7zty |
A | 25.8 | G0RY05_CHATD CNH domain-containing protein | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
|||||||
METAL |
|||||||
| 886 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6ze9[8] |
F |
ZN
|
A | 100.0 /100.0 |
1 /1 |
VPS39_HUMAN Vam6/Vps39-like protein |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO |
|||||||
| 886 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6ze9[8] |
C | VPS39_HUMAN Vam6/Vps39-like protein[34 aa] | A | 100.0 /100.0 |
9 /14 |
VPS39_HUMAN Vam6/Vps39-like protein |
|
|
6ze9[8] |
C | VPS39_HUMAN Vam6/Vps39-like protein[34 aa] | A | 100.0 /100.0 |
16 /16 |
VPS39_HUMAN Vam6/Vps39-like protein |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||