Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2719723 886 4 Q96JC1(VPS39_HUMAN) RecName: Full=Vam6/Vps39-like protein ;AltName: Full=TRAP1-like protein; Short=hVam6p;
QUERYSEQ 
MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCNRFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLFTCDLQHTETGEEVLRMCVAVKKKLQLYFWK
DREFHELQGDFSVPDVPKSMAWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIELQRPRFITSGGSNIIYVASN
HFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPVLSGAELEKAHLALIDYLTQKRSQLVKKLNDSDHQSSTSPLMEGTPTI
KSKKKLLQIIDTTLLKCYLHTNVALVAPLLRLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLGFLIENFKGLA
IPYLEHIIHVWEETGSRFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEYRQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAEEYCHKHYDRNKDGNKDVYLSLLRMYLSPPS
IHCLGPIKLELLEPKANLQAALQVLELHHSKLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNPADT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q96JC1(VPS39_HUMAN)]

886
region name description
1-886 CHAIN /note="Vam6/Vps39-like protein" /id="PRO_0000065901"
15-294 DOMAIN /note="CNH"
573-750 REPEAT /note="CHCR"
1-886 DISORDER predicted by DISOPRED

MONOMER
886
pdb_id a1 identity[%]2 description
6ze9 A 100.0 VPS39_HUMAN Vam6/Vps39-like protein
7zty A 25.8 G0RY05_CHATD CNH domain-containing protein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
METAL
886 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6ze9[8] F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 VPS39_HUMAN Vam6/Vps39-like protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
886 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6ze9[8] C VPS39_HUMAN Vam6/Vps39-like protein[34 aa] A 100.0
/100.0		 9
/14		 VPS39_HUMAN Vam6/Vps39-like protein
6ze9[8] C VPS39_HUMAN Vam6/Vps39-like protein[34 aa] A 100.0
/100.0		 16
/16		 VPS39_HUMAN Vam6/Vps39-like protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.