Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4055475 675 199 Q8N3R9(PALS1_HUMAN) RecName: Full=Protein PALS1 ;AltName: Full=MAGUK p55 subfamily member 5;AltName: Full=Membrane protein, palmitoylated 5 ;AltName: Full=Protein associated with Lin-7 1 ;
QUERYSEQ
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLL
LQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLY
NANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q8N3R9(PALS1_HUMAN)]

675
region name description
1-675 CHAIN /note="Protein PALS1" /id="PRO_0000094580"
120-177 DOMAIN /note="L27 1"
179-235 DOMAIN /note="L27 2"
256-336 DOMAIN /note="PDZ"
345-417 DOMAIN /note="SH3"
479-660 DOMAIN /note="Guanylate kinase-like"
1-345 REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions"
1-34 REGION /note="Disordered"
21-140 REGION /note="Interaction with PARD6B"
51-78 REGION /note="Disordered"
181-243 REGION /note="Interaction with LIN7C"
10-34 COMPBIAS /note="Basic and acidic residues"
57-78 COMPBIAS /note="Basic and acidic residues"
486-493 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
1-469 DISORDER predicted by DISOPRED

MONOMER
675
pdb_id a1 identity[%]2 description
4wsi A 100.0 MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5
3uit D 100.0 INADL_MOUSE MPP5_HUMAN LIN7B_RAT InaD-like protein, MAGUK p55 subfamily member 5, Protein lin-7 homolog B
2xkx A 36.6 DLG4_RAT DISKS LARGE HOMOLOG 4
2xkx B 36.6 DLG4_RAT DISKS LARGE HOMOLOG 4
5ypr A 39.5 DLG4_RAT Disks large homolog 4
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
675 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1y76[2] A MPDZ_RAT protein associated to tight junctions[62 aa] B 100.0
/100.0
4
/4
MPP5_HUMAN MAGUK p55 subfamily member 5
1y76[2] C MPDZ_RAT protein associated to tight junctions[62 aa] B 100.0
/100.0
26
/26
MPP5_HUMAN MAGUK p55 subfamily member 5
4uu5[1] B CRUM1_HUMAN PROTEIN CRUMBS HOMOLOG 1[14 aa] A 100.0
/100.0
13
/13
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
4wsi[2] C CRB_DROME Protein crumbs[18 aa] A 100.0
/100.0
37
/37
MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5
7m4r[1] C VEMP_SARS2 Envelope small membrane protein[9 aa] A 100.0
/100.0
11
/11
MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5
7ntj[1] B VEMP_SARS Envelope small membrane protein[4 aa] A 100.0
/100.0
13
/13
MPP5_HUMAN MAGUK p55 subfamily member 5
7ntj[1] D VEMP_SARS Envelope small membrane protein[7 aa] C 100.0
/100.0
13
/13
MPP5_HUMAN MAGUK p55 subfamily member 5
7ntk[3] C VEMP_SARS2 Envelope small membrane protein[7 aa] A 100.0
/100.0
12
/12
MPP5_HUMAN MAGUK p55 subfamily member 5
7ntk[1] H VEMP_SARS2 Envelope small membrane protein[6 aa] F 100.0
/100.0
14
/14
MPP5_HUMAN MAGUK p55 subfamily member 5
7qcs[2] C VEMP_SARS2 Envelope small membrane protein[5 aa] A 100.0
/100.0
14
/14
PALS1_HUMAN Protein PALS1
1vf6[4] A INADL_HUMAN PALS1-associated tight junction protein[58 aa] C 100.0
/91.7
20
/20
MPP5_MOUSE MAGUK p55 subfamily member 5
1vf6[4] B INADL_HUMAN PALS1-associated tight junction protein[60 aa] C 50.0
/91.7
2
/2
MPP5_MOUSE MAGUK p55 subfamily member 5
2vwf[1] B GAB2_HUMAN GRB2-ASSOCIATED-BINDING PROTEIN 2[14 aa] A 71.4
/51.2
7
/10
GRB2_HUMAN GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
2w0z[1] B GAB2_HUMAN GRB2-ASSOCIATED-BINDING PROTEIN 2[9 aa] A 71.4
/51.2
7
/10
GRB2_HUMAN GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
1gcq[1] C VAV_MOUSE VAV PROTO-ONCOGENE[69 aa] A 50.0
/43.4
10
/10
GRB2_HUMAN GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
1gcq[1] C VAV_MOUSE VAV PROTO-ONCOGENE[69 aa] B 33.3
/43.4
12
/13
GRB2_HUMAN GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
1io6[1] B A LIGAND PEPTIDE[10 aa] A 60.0
/43.4
10
/10
GRB2_HUMAN GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
1rzx[1] B Acetylated VKESLV Peptide[7 aa] A 58.3
/41.7
12
/12
O97111_DROME CG5884-PA
1x8s[1] B Pals1 peptide[9 aa] A 46.7
/41.7
15
/16
CG5884-PA
1n7f[2] C 8-mer peptide from interacting protein (liprin)[8 .. A 45.5
/41.5
11
/14
GRIP1_RAT AMPA receptor interacting protein GRIP
3tvt[1] B Q9NH88_DROME Partner of Inscuteable[14 aa] A 64.7
/41.1
17
/17
DLG1_DROME DLG1_DROME Disks large 1 tumor suppressor protein
3uat[1] B phosphor-LGN peptide[15 aa] A 68.4
/40.8
19
/19
DLG1_RAT Disks large homolog 1
1nf3[3] A CDC42_HUMAN G25K GTP-binding protein, placental isoform[194 aa.. C 33.3
/40.7
6
/23
PAR6B_MOUSE PAR-6B
6nid[2] E NRX1A_HUMAN Neurexin-1[5 aa] A 55.6
/40.2
9
/9
CSKP_HUMAN Peripheral plasma membrane protein CASK
6nid[1] D NRX1A_HUMAN Neurexin-1[6 aa] B 50.0
/40.2
12
/12
CSKP_HUMAN Peripheral plasma membrane protein CASK
5ypr[1] B Synthesized GK inhibitor[16 aa] A 53.8
/39.5
26
/26
DLG4_RAT Disks large homolog 4
3wp0[1] B L2GL2_HUMAN Lethal(2) giant larvae protein homolog 2[15 aa] A 61.5
/39.2
13
/13
DLG4_RAT Disks large homolog 4
3wp1[1] B L2GL2_HUMAN Lethal(2) giant larvae protein homolog 2[12 aa] A 71.4
/39.2
14
/14
DLG4_RAT Disks large homolog 4
5b64[1] B E9Q4K7_MOUSE Protein Kif13b[116 aa] A 52.4
/39.2
21
/21
DLG GK
5gnv[1] B MAP1A_MOUSE Microtubule-associated protein 1A[19 aa] A 60.0
/39.2
15
/15
DLG4_RAT Disks large homolog 4
5ypo[2] C SAPAP[14 aa] A 78.6
/39.2
14
/14
DLG4_RAT Disks large homolog 4
7f7g[2] C UNK-ARG-ILE-ARG-ARG-ASP-GLU-TYR-LEU-LYS-ALA-ILE-GL.. A 72.2
/39.2
18
/18
DLG4_RAT DLG4 GK domain
7f7i[6] G ACE-ARG-ILE-ARG-ARG-ASP-GLU-TYR-LEU-LYZ-ALA-ILE-GL.. A 57.9
/39.2
19
/19
DLG4_RAT Disks large homolog 4
5i7z[1] B Crb-3[7 aa] A 50.0
/39.0
14
/14
O97111_DROME LD29223p
6xa7[2] E VANG2_HUMAN Vang-like protein 2[6 aa] A 60.0
/36.4
5
/14
SCRIB_HUMAN Protein scribble homolog
6xa7[1] F VANG2_HUMAN Vang-like protein 2[4 aa] B 50.0
/36.4
6
/13
SCRIB_HUMAN Protein scribble homolog
6xa7[1] G VANG2_HUMAN Vang-like protein 2[5 aa] C 60.0
/36.4
5
/13
SCRIB_HUMAN Protein scribble homolog
7qrt[1] C TAX_HTL1C Protein Tax-1[8 aa] A 33.3
/36.4
6
/6
SCRIB_HUMAN Protein scribble homolog
7qrt[1] C TAX_HTL1C Protein Tax-1[8 aa] B 25.0
/36.4
4
/16
SCRIB_HUMAN Protein scribble homolog
2ejy[1] B GLPC_HUMAN Glycophorin C[6 aa] A 22.2
/34.5
9
/9
EM55_HUMAN 55 kDa erythrocyte membrane protein
3shw[1] B CXG1_HUMAN Gap junction gamma-1 protein[7 aa] A 14.3
/25.9
14
/15
ZO1_HUMAN Tight junction protein ZO-1
3tsz[1] B JAM1_HUMAN Junctional adhesion molecule A[10 aa] A 10.0
/25.7
20
/25
ZO1_HUMAN Tight junction protein ZO-1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
675 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4uu5[1] K PUN
2,2,4,4,6,6,8-heptamethylnonane[16 atoms]
A 100.0
/100.0
2
/2
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
1ex7[18] D 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 53.8
/37.8
13
/13
KGUA_YEAST GUANYLATE KINASE
1jxm[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 66.7
/39.8
6
/6
DLG4_RAT POSTSYNAPTIC DENSITY PROTEIN
1lvg[7] D 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 52.9
/42.1
17
/17
KGUA_MOUSE Guanylate kinase
1znx[15] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 66.7
/32.4
9
/10
KGUA_MYCTU Guanylate kinase
2j41[5] H 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
B 46.7
/35.0
15
/15
KGUA_STAAC GUANYLATE KINASE
2qor[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 43.8
/34.2
16
/16
A5K709_PLAVI Guanylate kinase
3lnc[2] C 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 46.2
/30.8
13
/14
KGUA_ANAPZ Guanylate kinase
1lvg[13] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 41.7
/42.1
12
/13
KGUA_MOUSE Guanylate kinase
6mfu[18] F ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 30.8
/29.9
13
/13
J9VQ84_CRYNH Guanylate kinase
2f3r[6] C G5P
P1-(5'-ADENOSYL)-P5-(5'-GUANOSYL) PENTAPHOSPHATE [..
A 40.0
/35.7
25
/25
KGUA_ECOLI Guanylate kinase
2f3r[6] C G5P
P1-(5'-ADENOSYL)-P5-(5'-GUANOSYL) PENTAPHOSPHATE [..
A 0.0
/35.7
4
/5
KGUA_ECOLI Guanylate kinase
4qrh[3] H 0O2
guanosine 5'-(tetrahydrogen triphosphate) 3'-(trih..
B 42.9
/34.9
21
/21
W6E076_STAAU Guanylate kinase
2an9[6] E GMP
GUANOSINE[20 atoms]
A 20.0
/34.3
5
/5
KGUA_ECOLI Guanylate kinase
2an9[6] E GMP
GUANOSINE[20 atoms]
A 0.0
/34.3
4
/5
KGUA_ECOLI Guanylate kinase
2f3t[4] G LGP
N9-1-HYDROXY-PROP-2-OXYMETHYL-GUANINE-3'-MONOPHOSP..
A 75.0
/34.3
8
/8
KGUA_ECOLI Guanylate kinase
1zny[4] B GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 66.7
/32.4
9
/10
KGUA_MYCTU Guanylate kinase
2an9[6] D GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 46.7
/34.3
15
/15
KGUA_ECOLI Guanylate kinase
7s5e[2] N AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..
D 14.3
/30.3
14
/14
B2FT06_STRMK Guanylate kinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
675 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1s4q[1] B CL
CHLORIDE ION[1 atoms]
A 0.0
/32.4
2
/2
KGUA_MYCTU Guanylate kinase
4uu5[3] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
4uu5[1] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
4uu5[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
4uu5[1] L CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
4uu5[1] J NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
1s96[6] D UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/34.3
2
/2
KGUA_ECOLI Guanylate kinase
3ney[1] I UNX
UNKNOWN ATOM OR ION[1 atoms]
A 62.5
/31.1
8
/8
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[1] J UNX
UNKNOWN ATOM OR ION[1 atoms]
A 33.3
/31.1
6
/6
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[15] K UNX
UNKNOWN ATOM OR ION[1 atoms]
A 33.3
/31.1
3
/3
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[17] L UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.1
2
/2
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[1] M UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.1
1
/1
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[4] N UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.1
2
/2
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[8] O UNX
UNKNOWN ATOM OR ION[1 atoms]
A 40.0
/31.1
5
/5
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[2] T UNX
UNKNOWN ATOM OR ION[1 atoms]
B 50.0
/31.1
2
/2
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[2] U UNX
UNKNOWN ATOM OR ION[1 atoms]
B 0.0
/31.1
2
/2
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[1] V UNX
UNKNOWN ATOM OR ION[1 atoms]
B 0.0
/31.1
3
/3
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[1] W UNX
UNKNOWN ATOM OR ION[1 atoms]
B 50.0
/31.1
2
/2
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[1] VA UNX
UNKNOWN ATOM OR ION[1 atoms]
F 0.0
/31.1
4
/4
EM55_HUMAN 55 kDa erythrocyte membrane protein
3o46[3] B UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/45.1
1
/1
MPP7_HUMAN MAGUK p55 subfamily member 7
3o46[9] C UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/45.1
2
/2
MPP7_HUMAN MAGUK p55 subfamily member 7
3o46[12] F UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/45.1
1
/1
MPP7_HUMAN MAGUK p55 subfamily member 7
3o46[3] H UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/45.1
1
/1
MPP7_HUMAN MAGUK p55 subfamily member 7
4qrh[3] F MG
MAGNESIUM ION[1 atoms]
B 0.0
/34.9
1
/1
W6E076_STAAU Guanylate kinase
7u5f[1] I MG
MAGNESIUM ION[1 atoms]
D 100.0
/36.8
1
/1
KGUA_PSEAE Guanylate kinase
1lvg[1] B K
POTASSIUM ION[1 atoms]
A 33.3
/42.1
3
/3
KGUA_MOUSE Guanylate kinase
2an9[6] C K
POTASSIUM ION[1 atoms]
A 33.3
/34.3
3
/3
KGUA_ECOLI Guanylate kinase
2j41[6] G K
POTASSIUM ION[1 atoms]
B 0.0
/35.0
3
/3
KGUA_STAAC GUANYLATE KINASE
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
675 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1y76[2] D MPP5_HUMAN MAGUK p55 subfamily member 5[60 aa] B 100.0
/100.0
6
/6
MPP5_HUMAN MAGUK p55 subfamily member 5
7m4r[1] B MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5[270 aa] A 100.0
/100.0
20
/20
MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5
7m4r[1] A MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5[360 aa] B 100.0
/100.0
19
/19
MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5
7qcs[2] B PALS1_HUMAN Protein PALS1[98 aa] A 100.0
/100.0
9
/9
PALS1_HUMAN Protein PALS1
7qcs[1] E PALS1_HUMAN Protein PALS1[82 aa] A 100.0
/100.0
2
/2
PALS1_HUMAN Protein PALS1
7qcs[1] A PALS1_HUMAN Protein PALS1[97 aa] E 100.0
/100.0
1
/1
PALS1_HUMAN Protein PALS1
3o46[3] A MPP7_HUMAN MAGUK p55 subfamily member 7[84 aa] A 58.3
/45.1
12
/12
MPP7_HUMAN MAGUK p55 subfamily member 7
3o46[3] A MPP7_HUMAN MAGUK p55 subfamily member 7[84 aa] A 22.2
/45.1
9
/9
MPP7_HUMAN MAGUK p55 subfamily member 7
1gri[4] B GRB2_HUMAN GROWTH FACTOR BOUND PROTEIN 2[211 aa] A 26.7
/43.4
15
/47
GRB2_HUMAN GROWTH FACTOR BOUND PROTEIN 2
1n7f[2] B GRIP1_RAT AMPA receptor interacting protein GRIP[86 aa] A 40.0
/41.5
5
/13
GRIP1_RAT AMPA receptor interacting protein GRIP
1ex6[1] B KGUA_YEAST GUANYLATE KINASE[186 aa] A 0.0
/37.8
2
/2
KGUA_YEAST GUANYLATE KINASE
1ex6[1] A KGUA_YEAST GUANYLATE KINASE[186 aa] B 0.0
/37.8
2
/2
KGUA_YEAST GUANYLATE KINASE
4f4j[1] A KGUA_YEAST Guanylate kinase[189 aa] B 60.0
/41.5
15
/15
KGUA_YEAST Guanylate kinase
4f4j[1] A KGUA_YEAST Guanylate kinase[189 aa] B 45.5
/41.5
22
/22
KGUA_YEAST Guanylate kinase
4f4j[1] B KGUA_YEAST Guanylate kinase[186 aa] A 14.3
/38.3
14
/14
KGUA_YEAST Guanylate kinase
4f4j[1] B KGUA_YEAST Guanylate kinase[186 aa] A 46.2
/38.3
26
/26
KGUA_YEAST Guanylate kinase
1kwa[2] A CSKP_HUMAN HCASK/LIN-2 PROTEIN[88 aa] A 0.0
/39.5
1
/1
CSKP_HUMAN HCASK/LIN-2 PROTEIN
1kwa[4] B CSKP_HUMAN HCASK/LIN-2 PROTEIN[86 aa] A 41.7
/39.5
12
/13
CSKP_HUMAN HCASK/LIN-2 PROTEIN
1kwa[4] B CSKP_HUMAN HCASK/LIN-2 PROTEIN[86 aa] A 100.0
/39.5
1
/5
CSKP_HUMAN HCASK/LIN-2 PROTEIN
2xkx[2] B DLG4_RAT DISKS LARGE HOMOLOG 4[718 aa] A 38.0
/36.6
242
/336
DLG4_RAT DISKS LARGE HOMOLOG 4
8egl[1] L KGUA_PSEAE Guanylate kinase[185 aa] A 0.0
/36.5
4
/6
KGUA_PSEAE Guanylate kinase
8egl[1] L KGUA_PSEAE Guanylate kinase[185 aa] B 0.0
/37.1
1
/1
KGUA_PSEAE Guanylate kinase
8egl[1] L KGUA_PSEAE Guanylate kinase[185 aa] C 33.3
/36.5
6
/6
KGUA_PSEAE Guanylate kinase
8egl[1] L KGUA_PSEAE Guanylate kinase[185 aa] K 40.0
/36.5
15
/32
KGUA_PSEAE Guanylate kinase
7jo7[3] D SCRIB_HUMAN Protein scribble homolog[93 aa] A 16.7
/36.4
6
/10
SCRIB_HUMAN Protein scribble homolog
7qrt[1] B SCRIB_HUMAN Protein scribble homolog[91 aa] A 60.0
/36.4
5
/10
SCRIB_HUMAN Protein scribble homolog
7jo7[1] B SCRIB_HUMAN Protein scribble homolog[90 aa] C 33.3
/36.4
6
/10
SCRIB_HUMAN Protein scribble homolog
7u5f[15] C KGUA_PSEAE Guanylate kinase[198 aa] A 35.3
/37.3
17
/34
KGUA_PSEAE Guanylate kinase
8egl[22] C KGUA_PSEAE Guanylate kinase[203 aa] A 33.3
/36.5
6
/6
KGUA_PSEAE Guanylate kinase
8egl[11] J KGUA_PSEAE Guanylate kinase[199 aa] B 0.0
/37.1
5
/8
KGUA_PSEAE Guanylate kinase
2j41[6] D KGUA_STAAC GUANYLATE KINASE[178 aa] C 40.0
/34.2
10
/20
KGUA_STAAC GUANYLATE KINASE
1s96[6] A KGUA_ECOLI Guanylate kinase[205 aa] A 30.0
/34.3
10
/10
KGUA_ECOLI Guanylate kinase
1s96[6] A KGUA_ECOLI Guanylate kinase[205 aa] A 28.6
/34.3
7
/11
KGUA_ECOLI Guanylate kinase
1s96[34] B KGUA_ECOLI Guanylate kinase[204 aa] A 31.6
/34.3
19
/35
KGUA_ECOLI Guanylate kinase
2an9[28] A KGUA_ECOLI Guanylate kinase[205 aa] A 28.6
/34.3
7
/9
KGUA_ECOLI Guanylate kinase
2an9[28] A KGUA_ECOLI Guanylate kinase[205 aa] A 33.3
/34.3
9
/9
KGUA_ECOLI Guanylate kinase
2anb[6] A KGUA_ECOLI Guanylate kinase[206 aa] A 0.0
/34.3
1
/1
KGUA_ECOLI Guanylate kinase
2anc[1] F KGUA_ECOLI Guanylate kinase[153 aa] B 50.0
/34.3
8
/11
KGUA_ECOLI Guanylate kinase
2anc[1] F KGUA_ECOLI Guanylate kinase[153 aa] D 33.3
/34.3
9
/9
KGUA_ECOLI Guanylate kinase
2anc[1] F KGUA_ECOLI Guanylate kinase[153 aa] E 38.9
/34.3
18
/32
KGUA_ECOLI Guanylate kinase
6nek[2] A Consensus PDZ domain[86 aa] A 32.1
/33.9
28
/56
Consensus PDZ domain
3tr0[2] A KGUA_COXBU Guanylate kinase[201 aa] A 40.0
/32.0
15
/26
KGUA_COXBU Guanylate kinase
3tau[2] B KGUA_LISMO Guanylate kinase[183 aa] A 0.0
/31.2
4
/25
KGUA_LISMO Guanylate kinase
3lnc[2] B KGUA_ANAPZ Guanylate kinase[188 aa] A 37.5
/30.8
16
/31
KGUA_ANAPZ Guanylate kinase
6wct[12] C B2FT06_STRMK Guanylate kinase[199 aa] A 47.4
/30.3
19
/32
B2FT06_STRMK Guanylate kinase
6mfu[4] D J9VQ84_CRYNH Guanylate kinase[215 aa] A 23.1
/29.9
13
/17
J9VQ84_CRYNH Guanylate kinase
7luy[6] F KGUA_BARHE Guanylate kinase[190 aa] A 26.7
/31.0
15
/31
KGUA_BARHE Guanylate kinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
675 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2qg1[1] B EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/41.4
3
/4
MPDZ_HUMAN Multiple PDZ domain protein
2qg1[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/41.4
4
/7
MPDZ_HUMAN Multiple PDZ domain protein
4qrh[1] O EDO
1,2-ETHANEDIOL[4 atoms]
D 0.0
/34.4
1
/1
W6E076_STAAU Guanylate kinase
4qrh[1] P EDO
1,2-ETHANEDIOL[4 atoms]
D 33.3
/34.4
6
/6
W6E076_STAAU Guanylate kinase
4qrh[2] Q EDO
1,2-ETHANEDIOL[4 atoms]
D 66.7
/34.4
3
/3
W6E076_STAAU Guanylate kinase
6nek[3] B EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/33.9
1
/1
Consensus PDZ domain
6nek[2] B EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/33.9
2
/3
Consensus PDZ domain
6nid[1] G EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/40.2
4
/4
CSKP_HUMAN Peripheral plasma membrane protein CASK
6xa7[1] I EDO
1,2-ETHANEDIOL[4 atoms]
B 20.0
/36.4
5
/6
SCRIB_HUMAN Protein scribble homolog
6xa7[3] J EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/36.4
1
/1
SCRIB_HUMAN Protein scribble homolog
6xa7[1] O EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/36.4
2
/3
SCRIB_HUMAN Protein scribble homolog
6xa7[1] N EDO
1,2-ETHANEDIOL[4 atoms]
D 42.9
/36.4
7
/8
SCRIB_HUMAN Protein scribble homolog
7jo7[1] E EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/36.4
4
/4
SCRIB_HUMAN Protein scribble homolog
7jo7[1] F EDO
1,2-ETHANEDIOL[4 atoms]
C 50.0
/36.4
2
/4
SCRIB_HUMAN Protein scribble homolog
7luy[2] I EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/31.0
2
/2
KGUA_BARHE Guanylate kinase
7luy[1] M EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/29.5
2
/2
KGUA_BARHE Guanylate kinase
7luy[2] Q EDO
1,2-ETHANEDIOL[4 atoms]
D 0.0
/31.0
3
/3
KGUA_BARHE Guanylate kinase
7luy[1] R EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/31.0
1
/1
KGUA_BARHE Guanylate kinase
7luy[1] U EDO
1,2-ETHANEDIOL[4 atoms]
E 0.0
/30.6
3
/3
KGUA_BARHE Guanylate kinase
7luy[1] V EDO
1,2-ETHANEDIOL[4 atoms]
E 0.0
/30.6
4
/4
KGUA_BARHE Guanylate kinase
7luy[1] X EDO
1,2-ETHANEDIOL[4 atoms]
E 33.3
/30.6
3
/5
KGUA_BARHE Guanylate kinase
7ntk[2] J EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
1
/2
MPP5_HUMAN MAGUK p55 subfamily member 5
7ntk[1] M EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
5
/5
MPP5_HUMAN MAGUK p55 subfamily member 5
3uit[2] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/3
INADL_MOUSE MPP5_HUMAN LIN7B_RAT InaD-like protein, MAGUK p55 subfamily member 5, P..
3uit[4] G ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
1
/2
INADL_MOUSE MPP5_HUMAN LIN7B_RAT InaD-like protein, MAGUK p55 subfamily member 5, P..
3uit[2] H ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/5
INADL_MOUSE MPP5_HUMAN LIN7B_RAT InaD-like protein, MAGUK p55 subfamily member 5, P..
3uit[2] J ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
3
/3
INADL_MOUSE MPP5_HUMAN LIN7B_RAT InaD-like protein, MAGUK p55 subfamily member 5, P..
3uit[1] K ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
1
/5
INADL_MOUSE MPP5_HUMAN LIN7B_RAT InaD-like protein, MAGUK p55 subfamily member 5, P..
3uit[1] O ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
1
/3
INADL_MOUSE MPP5_HUMAN LIN7B_RAT InaD-like protein, MAGUK p55 subfamily member 5, P..
4uu6[1] D ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
1
/1
MPP5_HUMAN MAGUK P55 SUBFAMILY MEMBER 5
7ntk[1] I FLC
CITRATE ANION[13 atoms]
B 100.0
/100.0
2
/2
MPP5_HUMAN MAGUK p55 subfamily member 5
1gcq[1] D MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 20.0
/43.4
5
/5
GRB2_HUMAN GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
1jxm[1] D GAI
GUANIDINE[4 atoms]
A 50.0
/39.8
2
/2
DLG4_RAT POSTSYNAPTIC DENSITY PROTEIN
1jxm[1] E MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 62.5
/39.8
8
/8
DLG4_RAT POSTSYNAPTIC DENSITY PROTEIN
1jxm[1] F MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 83.3
/39.8
6
/6
DLG4_RAT POSTSYNAPTIC DENSITY PROTEIN
2vvk[1] B GOL
GLYCEROL[6 atoms]
A 80.0
/44.2
5
/6
GRB2_HUMAN GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
3wp0[2] C GOL
GLYCEROL[6 atoms]
A 60.0
/39.2
5
/5
DLG4_RAT Disks large homolog 4
3wp0[3] D GOL
GLYCEROL[6 atoms]
A 25.0
/39.2
4
/4
DLG4_RAT Disks large homolog 4
3wp0[1] E GOL
GLYCEROL[6 atoms]
A 0.0
/39.2
2
/2
DLG4_RAT Disks large homolog 4
3wp0[1] F GOL
GLYCEROL[6 atoms]
A 33.3
/39.2
3
/3
DLG4_RAT Disks large homolog 4
3wp0[1] G GOL
GLYCEROL[6 atoms]
A 75.0
/39.2
4
/4
DLG4_RAT Disks large homolog 4
3wp0[2] H GOL
GLYCEROL[6 atoms]
A 33.3
/39.2
6
/6
DLG4_RAT Disks large homolog 4
5b64[1] I GOL
GLYCEROL[6 atoms]
A 66.7
/39.2
3
/3
DLG GK
5ypo[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/39.2
4
/4
DLG4_RAT Disks large homolog 4
5ypo[1] G GOL
GLYCEROL[6 atoms]
A 50.0
/39.2
2
/2
DLG4_RAT Disks large homolog 4
5i7z[1] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 33.3
/39.0
3
/3
O97111_DROME LD29223p
1ex7[4] B SO4
SULFATE ION[5 atoms]
A 0.0
/37.8
3
/3
KGUA_YEAST GUANYLATE KINASE
1ex7[31] C SO4
SULFATE ION[5 atoms]
A 14.3
/37.8
7
/7
KGUA_YEAST GUANYLATE KINASE
1kjw[3] B SO4
SULFATE ION[5 atoms]
A 25.0
/37.0
4
/4
DLG4_RAT POSTSYNAPTIC DENSITY PROTEIN 95
1kjw[16] C SO4
SULFATE ION[5 atoms]
A 25.0
/37.0
4
/4
DLG4_RAT POSTSYNAPTIC DENSITY PROTEIN 95
1z6g[9] B SO4
SULFATE ION[5 atoms]
A 25.0
/31.8
8
/8
Q8I2M1_PLAF7 guanylate kinase
1z6g[1] D SO4
SULFATE ION[5 atoms]
A 25.0
/31.8
4
/4
Q8I2M1_PLAF7 guanylate kinase
1z6g[1] E SO4
SULFATE ION[5 atoms]
A 16.7
/31.8
6
/6
Q8I2M1_PLAF7 guanylate kinase
1z6g[1] F SO4
SULFATE ION[5 atoms]
A 0.0
/31.8
1
/2
Q8I2M1_PLAF7 guanylate kinase
3ney[6] H SO4
SULFATE ION[5 atoms]
A 100.0
/31.1
2
/2
EM55_HUMAN 55 kDa erythrocyte membrane protein
3ney[1] Q SO4
SULFATE ION[5 atoms]
B 0.0
/31.1
3
/3
EM55_HUMAN 55 kDa erythrocyte membrane protein
3wp1[1] D SO4
SULFATE ION[5 atoms]
A 0.0
/39.2
4
/4
DLG4_RAT Disks large homolog 4
3wp1[1] E SO4
SULFATE ION[5 atoms]
A 50.0
/39.2
4
/4
DLG4_RAT Disks large homolog 4
4f4j[1] F SO4
SULFATE ION[5 atoms]
A 0.0
/38.3
2
/2
KGUA_YEAST Guanylate kinase
4f4j[2] E SO4
SULFATE ION[5 atoms]
B 0.0
/41.5
2
/2
KGUA_YEAST Guanylate kinase
4f4j[2] G SO4
SULFATE ION[5 atoms]
B 33.3
/41.5
3
/3
KGUA_YEAST Guanylate kinase
5gnv[1] D SO4
SULFATE ION[5 atoms]
A 25.0
/39.2
4
/4
DLG4_RAT Disks large homolog 4
7luy[6] H SO4
SULFATE ION[5 atoms]
A 33.3
/31.0
3
/3
KGUA_BARHE Guanylate kinase
7luy[1] J SO4
SULFATE ION[5 atoms]
A 50.0
/31.0
2
/3
KGUA_BARHE Guanylate kinase
7qrt[1] E SO4
SULFATE ION[5 atoms]
A 0.0
/36.4
1
/1
SCRIB_HUMAN Protein scribble homolog
7qrt[1] G SO4
SULFATE ION[5 atoms]
B 50.0
/36.4
4
/5
SCRIB_HUMAN Protein scribble homolog
2qor[1] C POP
PYROPHOSPHATE 2-[5 atoms]
A 28.6
/34.2
7
/7
A5K709_PLAVI Guanylate kinase
1kgd[1] B FMT
FORMIC ACID[3 atoms]
A 100.0
/32.7
5
/5
CSKP_HUMAN PERIPHERAL PLASMA MEMBRANE CASK
1kgd[1] D FMT
FORMIC ACID[3 atoms]
A 0.0
/32.7
1
/1
CSKP_HUMAN PERIPHERAL PLASMA MEMBRANE CASK
1kgd[3] E FMT
FORMIC ACID[3 atoms]
A 25.0
/32.7
4
/4
CSKP_HUMAN PERIPHERAL PLASMA MEMBRANE CASK
1kgd[1] F FMT
FORMIC ACID[3 atoms]
A 33.3
/32.7
3
/3
CSKP_HUMAN PERIPHERAL PLASMA MEMBRANE CASK
1s4q[2] D FMT
FORMIC ACID[3 atoms]
A 33.3
/32.4
3
/3
KGUA_MYCTU Guanylate kinase
1s4q[1] E FMT
FORMIC ACID[3 atoms]
A 0.0
/32.4
3
/4
KGUA_MYCTU Guanylate kinase
1z6g[1] G EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 22.2
/31.8
9
/9
Q8I2M1_PLAF7 guanylate kinase
1s96[6] C PO4
PHOSPHATE ION[5 atoms]
A 25.0
/34.3
4
/4
KGUA_ECOLI Guanylate kinase
6wct[1] F PO4
PHOSPHATE ION[5 atoms]
A 14.3
/30.3
7
/7
B2FT06_STRMK Guanylate kinase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.