Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4058345 424 500 P47901(V1BR_HUMAN) RecName: Full=Vasopressin V1b receptor ; Short=V1bR;AltName: Full=AVPR V1b;AltName: Full=AVPR V3;AltName: Full=Antidiuretic hormone receptor 1b;AltName: Full=Vasopressin V3 receptor;
QUERYSEQ
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQST
YLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P47901(V1BR_HUMAN)]

424
region name description
1-424 CHAIN /note="Vasopressin V1b receptor" /id="PRO_0000070203"
1-35 TOPO_DOM /note="Extracellular"
36-59 TRANSMEM /note="Helical; Name=1"
60-71 TOPO_DOM /note="Cytoplasmic"
72-93 TRANSMEM /note="Helical; Name=2"
94-108 TOPO_DOM /note="Extracellular"
109-130 TRANSMEM /note="Helical; Name=3"
131-151 TOPO_DOM /note="Cytoplasmic"
152-173 TRANSMEM /note="Helical; Name=4"
174-201 TOPO_DOM /note="Extracellular"
202-222 TRANSMEM /note="Helical; Name=5"
223-283 TOPO_DOM /note="Cytoplasmic"
284-303 TRANSMEM /note="Helical; Name=6"
304-321 TOPO_DOM /note="Extracellular"
322-341 TRANSMEM /note="Helical; Name=7"
342-424 TOPO_DOM /note="Cytoplasmic"
1-22 REGION /note="Disordered"
398-417 REGION /note="Disordered"
1-424 DISORDER predicted by DISOPRED

MONOMER
424
pdb_id a1 identity[%]2 description
7ryc B 63.9 OXYR_HUMAN Oxytocin receptor
7xrr A 28.3 OX2R_HUMAN Orexin receptor type 2
4yay A 25.6 C562_ECOLX AGTR1_HUMAN Soluble cytochrome b562,Type-1 angiotensin II receptor
2hpy A 21.3 OPSD_BOVIN Rhodopsin
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
424 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7qvm[1] A A0A1W2PS82_HUMAN B3KP89_HUMAN GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. E 81.8
/64.3
11
/11
OXYR_HUMAN Oxytocin receptor
7qvm[1] D NEU1_HUMAN Oxytocin[10 aa] E 70.0
/64.3
20
/20
OXYR_HUMAN Oxytocin receptor
7ryc[1] A NEU1_HUMAN Oxytocin[10 aa] B 71.4
/63.9
21
/21
OXYR_HUMAN Oxytocin receptor
7bb6[2] E arginine-vasopressin[10 aa] A 80.0
/55.5
10
/12
V2R_HUMAN Vasopressin V2 receptor
7dw9[1] G CYS-TYR-PHE-GLN-ASN-CYS-PRO-ARG-GLY-NH2[10 aa] A 69.2
/52.3
26
/27
V2R_HUMAN Vasopressin V2 receptor
7kh0[1] D NEU2_HUMAN Arg-vasopressin[10 aa] A 66.7
/54.7
24
/24
V2R_HUMAN Vasopressin V2 receptor
7r0c[1] B AVP[10 aa] A 62.5
/53.8
16
/16
V2R_HUMAN Vasopressin V2 receptor
7dw9[1] B Guanine nucleotide-binding protein G(s) subunit al.. A 53.3
/52.3
15
/18
V2R_HUMAN Vasopressin V2 receptor
7xjh[2] A GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. E 87.5
/36.6
8
/23
ADRB3_CANLF Beta-3 adrenergic receptor
7xwo[1] D G324[229 aa] A 55.6
/36.4
9
/15
C562_ECOLX NK2R_HUMAN Soluble cytochrome b562,Substance-K receptor
7xwo[1] F HIS-LYS-THR-ASP-SER-PHE-VAL-GLY-LEU-MET-NH2[11 aa].. A 16.7
/36.4
6
/17
C562_ECOLX NK2R_HUMAN Soluble cytochrome b562,Substance-K receptor
7f9y[2] A Engineered G-alpha-q subunit[228 aa] F 42.9
/35.3
14
/18
Soluble cytochrome b562
7f9y[1] C GHRL_HUMAN Ghrelin-28[15 aa] F 33.3
/35.3
3
/17
Soluble cytochrome b562
7w2z[1] F GHRL_HUMAN Appetite-regulating hormone[16 aa] B 45.5
/35.2
11
/26
GHSR_HUMAN Growth hormone secretagogue receptor type 1
5xjm[2] D Sar1, Ile8-angiotensin II[8 aa] A 35.3
/33.8
17
/22
AGTR2_HUMAN C562_ECOLX AGTR2_HUMAN Type-2 angiotensin II receptor,Soluble cytochrome ..
6do1[2] H Angiotensin-like peptide S1I8[8 aa] A 28.6
/26.9
7
/26
AGTR1_HUMAN C562_ECOLX AGTR1_HUMAN Type-1 angiotensin II receptor,Soluble cytochrome ..
7c6a[1] A IgG Light Chain[211 aa] C 50.0
/34.6
4
/7
AGTR2_HUMAN C562_ECOLX AGTR2_HUMAN Type-2 angiotensin II receptor,Soluble cytochrome ..
7na7[1] F GHRL_HUMAN Ghrelin-27[12 aa] E 33.3
/34.6
12
/25
GHSR_HUMAN Growth hormone secretagogue receptor type 1
5xjm[2] B FabH[220 aa] A 33.3
/33.8
12
/18
AGTR2_HUMAN C562_ECOLX AGTR2_HUMAN Type-2 angiotensin II receptor,Soluble cytochrome ..
5xjm[2] C FabL[212 aa] A 0.0
/33.8
2
/5
AGTR2_HUMAN C562_ECOLX AGTR2_HUMAN Type-2 angiotensin II receptor,Soluble cytochrome ..
6jod[1] C C562_ECOLX C562_ECOLX Soluble cytochrome b562,Soluble cytochrome b562[59.. A 0.0
/34.3
3
/4
AGTR2_HUMAN Type-2 angiotensin II receptor
7mbx[2] E CCKN_HUMAN Cholecystokinin-8[9 aa] F 11.1
/33.7
18
/27
CCKAR_HUMAN Cholecystokinin receptor type A
7xou[1] A CCK-8[9 aa] F 5.3
/33.7
19
/25
CCKAR_HUMAN Cholecystokinin receptor type A
8ia7[1] F CCK-8[9 aa] A 14.3
/34.1
21
/21
GASR_HUMAN Gastrin/cholecystokinin type B receptor
7xow[2] E GNAQ_HUMAN Guanine nucleotide-binding protein G(q) subunit al.. A 42.9
/34.1
14
/16
GASR_HUMAN Gastrin/cholecystokinin type B receptor
7xow[1] F GAST_HUMAN Gastrin[8 aa] A 10.5
/34.1
19
/19
GASR_HUMAN Gastrin/cholecystokinin type B receptor
7na7[2] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 40.0
/34.6
15
/18
GHSR_HUMAN Growth hormone secretagogue receptor type 1
6ko5[1] B Fab7881 Heavy Chain[218 aa] A 20.0
/33.8
10
/10
C562_ECOLX GHSR_HUMAN Chimera of Soluble cytochrome b562 and Growth horm..
6ko5[1] C Fab7881 Light Chain[219 aa] A 0.0
/33.8
2
/2
C562_ECOLX GHSR_HUMAN Chimera of Soluble cytochrome b562 and Growth horm..
7w55[1] A Guanine nucleotide-binding protein G(q) subunit al.. F 25.0
/26.7
24
/29
Neuromedin-U receptor 2
7wkd[1] A Gq[232 aa] E 33.3
/33.7
9
/19
TRFR_HUMAN Thyrotropin-releasing hormone receptor
7wkd[1] F TRH[3 aa] E 25.0
/33.7
4
/17
TRFR_HUMAN Thyrotropin-releasing hormone receptor
6ni3[1] A GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. D 33.3
/26.1
18
/20
A0A097J809_BPT4 ADRB2_HUMAN Endolysin,Beta-2 adrenergic receptor chimera
7bb6[2] C GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. A 64.3
/55.5
14
/17
V2R_HUMAN Vasopressin V2 receptor
7dhi[1] A GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. E 18.2
/24.3
22
/24
ADRB2_HUMAN Beta-2 adrenergic receptor
7kh0[1] C GNAI3_HUMAN GNAS2-2_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 66.7
/54.7
18
/20
V2R_HUMAN Vasopressin V2 receptor
7xou[2] B GNAS2_HUMAN Isoform Gnas-2 of Guanine nucleotide-binding prote.. F 50.0
/33.7
16
/20
CCKAR_HUMAN Cholecystokinin receptor type A
7ezh[3] F Cholecystokinin-8[9 aa] C 17.6
/33.7
17
/26
CCKAR_HUMAN Cholecystokinin receptor type A
7ezk[1] A GNAI1_HUMAN GNAS2_HUMAN GNAI1_HUMAN GNAS2_HUMAN Chimera of Guanine nucleotide-binding protein G(i).. C 55.0
/33.7
20
/23
CCKAR_HUMAN Cholecystokinin receptor type A
7ezm[1] A GNAI1_HUMAN GNAQ_HUMAN fusion protein of Guanine nucleotide-binding prote.. C 47.4
/33.7
19
/29
CCKAR_HUMAN Cholecystokinin receptor type A
7mbx[1] A GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. F 64.3
/33.7
14
/19
CCKAR_HUMAN Cholecystokinin receptor type A
7wq3[2] F GALA_HUMAN Galanin[16 aa] A 25.0
/28.2
12
/18
GALR1_HUMAN Galanin receptor type 1
7xbd[1] F GALA_HUMAN Galanin[16 aa] A 25.0
/33.0
16
/17
GALR2_HUMAN Galanin receptor type 2
7xjj[1] C GALA_HUMAN Galanin[17 aa] D 27.3
/29.2
11
/18
GALR1_HUMAN Galanin receptor type 1
7xjl[1] A spexin[14 aa] F 22.2
/33.5
18
/19
GALR2_HUMAN Galanin receptor type 2
7f8v[1] A GNAI2_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 45.5
/33.3
11
/16
GASR_HUMAN Gastrin/cholecystokinin type B receptor
7f8v[2] D Gastrin-17[17 aa] E 11.1
/33.3
27
/30
GASR_HUMAN Gastrin/cholecystokinin type B receptor
7f8w[1] A GNAQ_HUMAN Guanine nucleotide-binding protein G(q) subunit al.. F 31.2
/33.3
16
/21
GASR_HUMAN Gastrin/cholecystokinin type B receptor
7wq4[1] B GALA_HUMAN Galanin[13 aa] A 27.3
/33.2
22
/22
GALR2_HUMAN Galanin receptor type 2
7wq4[1] C Engineered Guanine nucleotide-binding protein G(q).. A 45.0
/33.2
20
/21
GALR2_HUMAN Galanin receptor type 2
7f8x[1] B ASP-SMF-NLE-GLY-TRP-NLE-OEM-MEA-NH2 (NN9056)[9 aa].. A 10.5
/33.2
19
/27
CCKAR_HUMAN ENLYS_BPT4 CCKAR_HUMAN Cholecystokinin receptor type A,Endolysin
7vgz[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 25.0
/33.0
4
/16
MTR1A_HUMAN Melatonin receptor type 1A
8i95[2] F EP54 ligand[9 aa] E 36.4
/32.9
11
/24
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8i9a[1] A Guanine nucleotide-binding protein G(q) subunit al.. E 36.4
/32.9
11
/17
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
7db6[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 25.0
/32.7
4
/20
MTR1A_HUMAN Melatonin receptor type 1A
4rwa[4] D bifunctional peptide[5 aa] A 25.0
/33.3
12
/12
C562_ECOLX Soluble cytochrome b562,Delta-type opioid receptor..
8ef6[1] G GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. F 36.8
/28.4
19
/19
OPRM_HUMAN Mu-type opioid receptor
8f7q[1] I GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. G 25.0
/28.4
16
/16
OPRM_HUMAN Mu-type opioid receptor
8f7s[1] H GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. F 40.0
/32.2
15
/15
OPRD_HUMAN Delta-type opioid receptor
8f7s[2] B DA2D_PHYBI deltorphin[8 aa] A 26.3
/32.2
19
/19
OPRD_HUMAN Delta-type opioid receptor
8f7s[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 35.0
/32.2
20
/21
OPRD_HUMAN Delta-type opioid receptor
6h7j[2] C Camelid antibody fragment Nb80[119 aa] B 29.2
/32.0
24
/27
ADRB1_MELGA Beta-1 adrenergic receptor
6ibl[2] B Camelid antibody fragment Nb80[119 aa] A 34.8
/32.2
23
/26
THIO_ECOLI ADRB1_MELGA Thioredoxin 1,Beta-1 adrenergic receptor
7w2z[1] A A0A1W2PS82_HUMAN GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. B 42.9
/35.2
14
/16
GHSR_HUMAN Growth hormone secretagogue receptor type 1
7xjj[1] A A0A1W2PRJ7_HUMAN A0A1W2PP38_HUMAN GNAO_HUMAN G protein subunit alpha o1,Guanine nucleotide-bind.. D 33.3
/29.2
9
/21
GALR1_HUMAN Galanin receptor type 1
7y24[1] A GNAO_HUMAN GNAO_HUMAN GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. F 54.5
/28.2
11
/15
SSR2_HUMAN Somatostatin receptor type 2
8i95[5] A GNAO_HUMAN GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. E 37.5
/32.9
8
/17
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8hk2[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 37.5
/31.9
8
/19
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8hk2[1] D CO3_HUMAN C3a anaphylatoxin[73 aa] A 28.6
/31.9
7
/26
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8i9l[1] F CO3_HUMAN C3a anaphylatoxin[70 aa] E 14.3
/31.9
7
/21
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8j6d[1] D EP141 peptide agonist[10 aa] C 28.6
/31.9
7
/19
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
7x1u[2] F Endogenous Peptide Agonist TRH[4 aa] B 20.0
/33.7
5
/18
TRFR_HUMAN Thyrotropin-releasing hormone receptor
7xw9[1] B Guanine nucleotide-binding protein G(q) subunit al.. A 33.3
/31.8
9
/23
TRFR_HUMAN Thyrotropin-releasing hormone receptor
6pt2[2] C Peptide agonist KGCHM07[5 aa] A 30.0
/31.5
20
/21
Delta opioid receptor
7s0g[1] C GNAI1_RAT GNAS2_BOVIN Guanine nucleotide-binding protein G(i) subunit al.. A 46.7
/31.6
15
/17
Beta1-Adrenergic Receptor
7jjo[3] C GNAS2_BOVIN Guanine nucleotide-binding protein G(s) subunit al.. E 43.8
/31.5
16
/18
Beta1-Adrenergic Receptor
6h7j[10] A THIO_ECOLI Thioredoxin 1[106 aa] B 100.0
/32.0
2
/3
ADRB1_MELGA Beta-1 adrenergic receptor
7s0f[1] C GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit al.. A 37.5
/31.3
16
/17
Beta1-Adrenergic Receptor
7xmt[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 44.4
/31.2
18
/20
SSR4_HUMAN Somatostatin receptor type 4
4mqs[2] B Nanobody 9-8[121 aa] A 28.6
/29.8
7
/12
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2
7y89[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 33.3
/31.0
15
/21
GPR17_HUMAN Uracil nucleotide/cysteinyl leukotriene receptor
8ia8[1] A ALA-SER-LYS-LEU-GLY-LEU-ALA-ARG[8 aa] B 25.0
/31.0
12
/19
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
7wvw[1] A FME-TYR-PHE-ILE-ASN-ILE-LEU-THE-LEU[7 aa] B 29.4
/30.9
17
/21
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
7wvx[1] A HUNIN_HUMAN Humanin[15 aa] B 35.0
/30.9
20
/23
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
7wvx[1] C GNAI2_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. B 29.4
/30.9
17
/17
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
7x1t[1] F Taltirelin[5 aa] B 20.0
/30.8
5
/14
TRFR_HUMAN Thyrotropin-releasing hormone receptor
8dzr[1] B G alpha gustducin protein[205 aa] A 50.0
/30.8
10
/21
OPRK_HUMAN Kappa-type opioid receptor
7wj5[1] F Somatostatin-14 (SST-14)[12 aa] E 40.9
/27.2
22
/22
C562_ECOLX SSR2_HUMAN Soluble cytochrome b562,Somatostatin receptor type..
7xat[1] F SMS_HUMAN Somatostatin-14[12 aa] A 35.0
/27.2
20
/20
SSR2_HUMAN Somatostatin receptor type 2,LargeBit
7xms[1] F SMS_HUMAN Somatostatin-14[12 aa] A 21.1
/30.8
19
/19
SSR4_HUMAN Somatostatin receptor type 4
7xms[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 47.6
/30.8
21
/21
SSR4_HUMAN Somatostatin receptor type 4
7t6v[1] F Synthetic peptide[5 aa] A 33.3
/29.8
15
/17
FPR2_HUMAN N-formyl peptide receptor 2
7wvv[1] A FME-LEU-PHE-ILE-ILE[5 aa] B 25.0
/30.7
16
/20
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
7wvv[3] C GNAI2_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. B 41.2
/30.7
17
/19
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
7wvy[1] A B4DMD5_HUMAN Amyloid-beta A4 protein[16 aa] B 37.5
/30.7
24
/28
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
8hk3[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. C 33.3
/30.5
9
/19
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
7sqo[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 66.7
/30.4
6
/13
OX2R_HUMAN Orexin receptor type 2
7w0l[2] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 41.7
/30.1
12
/13
C562_ECOLX APJ_HUMAN Soluble cytochrome b562,Apelin receptor
7w0m[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 33.3
/30.1
12
/14
C562_ECOLX APJ_HUMAN Soluble cytochrome b562,Apelin receptor
7w0n[4] H ELA_HUMAN Apelin receptor early endogenous ligand[15 aa] D 23.5
/30.1
17
/18
C562_ECOLX APJ_HUMAN Soluble cytochrome b562,Apelin receptor
7w0o[2] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 30.0
/30.1
10
/12
C562_ECOLX APJ_HUMAN Soluble cytochrome b562,Apelin receptor
8f7x[1] B PNOC_HUMAN Nociceptin[14 aa] A 33.3
/30.1
21
/22
OPRX_HUMAN Nociceptin receptor
8f7x[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 21.1
/30.1
19
/19
OPRX_HUMAN Nociceptin receptor
8kfx[3] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 42.1
/29.9
19
/25
CCR8_HUMAN C-C chemokine receptor type 8,Fusion protein
6oik[1] B GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. A 75.0
/29.8
4
/15
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,Muscarinic ac..
7t8x[1] B GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. A 50.0
/29.8
8
/17
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,muscarinic ac..
7t90[3] B GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. A 75.0
/29.8
4
/13
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2
6lw5[1] B TRP-LYS-TYR-MET-VAL-QXV[6 aa] A 38.1
/30.4
21
/23
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
6omm[1] B Peptide agonist[6 aa] A 33.3
/29.8
15
/17
FPR2_HUMAN N-formyl peptide receptor 2
6omm[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 32.0
/29.8
25
/25
FPR2_HUMAN N-formyl peptide receptor 2
7t6s[2] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 35.0
/29.8
20
/20
FPR2_HUMAN N-formyl peptide receptor 2
7t6u[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. F 36.4
/29.8
22
/22
FPR2_HUMAN N-formyl peptide receptor 2
7t6u[1] E Synthetic peptide[8 aa] F 41.2
/29.8
17
/20
FPR2_HUMAN N-formyl peptide receptor 2
6do1[5] C Nanobody Nb.AT110i1[125 aa] A 18.2
/26.9
11
/21
AGTR1_HUMAN C562_ECOLX AGTR1_HUMAN Type-1 angiotensin II receptor,Soluble cytochrome ..
6os1[1] C TRV023 peptide[8 aa] A 50.0
/29.8
4
/23
AGTR1_HUMAN C562_ECOLX AGTR1_HUMAN Type-1 angiotensin II receptor,Soluble cytochrome ..
6os2[1] C TRV026 peptide[8 aa] A 57.1
/29.8
7
/27
AGTR1_HUMAN C562_ECOLX AGTR1_HUMAN Type-1 angiotensin II receptor,Soluble cytochrome ..
8feg[1] F ACE-TYR-ALA-DTY-THR-THR-CYS-THR-DPN-XT9[10 aa] E 36.4
/29.4
11
/23
OPRK_HUMAN Kappa-type opioid receptor
8k2w[1] A Nb6[101 aa] B 36.4
/29.4
11
/11
C562_ECOLX CXCR3_HUMAN OPRK_HUMAN CXCR3_HUMAN Soluble cytochrome b562,C-X-C chemokine receptor t..
3oe0[2] B Polyphemusin analog, CXC chemokine receptor antago.. A 16.7
/29.3
24
/26
CXCR4_HUMAN LYS_BPT4 CXCR4_HUMAN C-X-C chemokine receptor type 4, Lysozyme Chimera
8dzs[1] B GNAZ_HUMAN Guanine nucleotide-binding protein G(z) subunit al.. A 62.5
/29.2
8
/19
OPRK_HUMAN Kappa-type opioid receptor
8ic0[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 36.4
/29.2
11
/21
CXCR1_HUMAN C-X-C chemokine receptor type 1
8ic0[1] F IL8_HUMAN Interleukin-8[69 aa] A 26.7
/29.2
15
/25
CXCR1_HUMAN C-X-C chemokine receptor type 1
7l1u[1] F OREX_HUMAN Orexin[10 aa] E 25.0
/29.2
20
/21
Q548Y0_HUMAN Hypocretin receptor type 2
7l1v[1] F Synthetic nanobody 51 (Sb51)[111 aa] E 22.2
/29.1
18
/20
Q548Y0_HUMAN Hypocretin receptor type 2
8dzq[1] D GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit al.. E 50.0
/29.1
8
/21
OPRK_HUMAN Kappa-type opioid receptor
6meo[2] A Q70145_9HIV1 Envelope glycoprotein gp160[398 aa] C 9.5
/29.0
21
/35
CCR5_HUMAN C-C chemokine receptor type 5
5uiw[1] B CCL5_HUMAN C-C motif chemokine 5[68 aa] A 12.9
/26.7
31
/40
CCR5_HUMAN RUBR_CLOPA CCR5_HUMAN C-C chemokine receptor type 5,Rubredoxin chimera
7o7f[1] E CCL5_HUMAN C-C motif chemokine 5[67 aa] C 12.5
/29.0
24
/31
CCR5_HUMAN C-C chemokine receptor type 5
7o7f[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. C 30.8
/29.0
13
/17
CCR5_HUMAN C-C chemokine receptor type 5
7ymj[1] B Nb6[116 aa] A 44.4
/26.9
9
/9
alpha1A-adrenergic receptor
8hn1[1] C Nb6[111 aa] B 50.0
/27.3
12
/12
ADA1A_HUMAN Alpha-1A adrenergic receptor
8hnn[1] A Nb6[114 aa] B 33.3
/28.9
12
/12
C562_ECOLX CXCR3_HUMAN OPRK_HUMAN CXCR3_HUMAN Soluble cytochrome b562,C-X-C chemokine receptor t..
8hnk[4] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 21.4
/28.4
14
/22
C562_ECOLX CXCR3_HUMAN LUCI_OPLGR Soluble cytochrome b562,C-X-C chemokine receptor t..
8k2x[1] F CXL10_HUMAN C-X-C motif chemokine 10[8 aa] D 14.3
/28.9
14
/17
C562_ECOLX CXCR3_HUMAN LUCI_OPLGR Soluble cytochrome b562,C-X-C chemokine receptor t..
5cxv[1] B FLAG peptide[7 aa] A 0.0
/28.9
3
/12
ACM1_HUMAN ENLYS_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin,Mus..
6dde[2] F DAMGO[5 aa] E 20.0
/28.8
15
/15
OPRM_MOUSE Mu-type opioid receptor
7ezh[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. C 50.0
/33.7
14
/19
CCKAR_HUMAN Cholecystokinin receptor type A
8efq[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 38.9
/28.8
18
/21
OPRM_HUMAN Mu-type opioid receptor
8efq[1] D DAMGO[4 aa] E 30.8
/28.8
13
/13
OPRM_HUMAN Mu-type opioid receptor
8jbg[1] E TKNK_HUMAN Neurokinin-B[8 aa] A 16.7
/28.6
12
/23
Neuromedin-K receptor (NK3R-pFastbac1)
8jbg[1] F Guanine nucleotide-binding protein Gq (G324)[229 a.. A 41.2
/28.6
17
/20
Neuromedin-K receptor (NK3R-pFastbac1)
7xtc[1] A GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. E 50.0
/28.6
8
/22
C562_ECOLX 5HT7R_HUMAN Soluble cytochrome b562,5-hydroxytryptamine recept..
7t2g[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 25.9
/28.5
27
/27
C562_ECOLX OPRM_MOUSE Soluble cytochrome b562,Mu-type opioid receptor
7f1q[2] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 50.0
/28.2
18
/22
CCL3_HUMAN CCR5_HUMAN C-C motif chemokine 3,C-C chemokine receptor type ..
7f1s[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 46.7
/28.8
15
/19
CCR5_HUMAN C-C chemokine receptor type 5
7vh0[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 26.7
/31.6
15
/15
MTR1B_HUMAN Melatonin receptor type 1B
7wj5[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 46.7
/27.2
15
/17
C562_ECOLX SSR2_HUMAN Soluble cytochrome b562,Somatostatin receptor type..
7x9a[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 27.8
/24.5
18
/18
NPY1R_HUMAN Neuropeptide Y receptor type 1
7ykd[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. B 20.0
/24.7
15
/21
CML1_HUMAN Chemerin-like receptor 1
7yoo[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 40.0
/26.8
15
/16
NPY2R_HUMAN Neuropeptide Y receptor type 2
8dzp[2] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 44.4
/28.9
9
/23
OPRK_HUMAN Kappa-type opioid receptor
8ia8[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. B 42.9
/31.0
7
/15
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8u1u[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 50.0
/28.5
12
/18
CCL1_HUMAN CCR8_HUMAN A0A6M5E0N3_ADE02 C-C motif chemokine 1,C-C chemokine receptor type ..
8hnk[1] E CXL11_HUMAN C-X-C motif chemokine 11[73 aa] D 16.7
/28.4
24
/31
C562_ECOLX CXCR3_HUMAN LUCI_OPLGR Soluble cytochrome b562,C-X-C chemokine receptor t..
8jbh[1] E TKN1_HUMAN peptide from Protachykinin-1[7 aa] A 6.7
/28.4
15
/23
NK3R-pFastbac1
8jbh[1] F Guanine nucleotide-binding protein Gq subunit alph.. A 50.0
/28.4
16
/19
NK3R-pFastbac1
7ul4[1] B Megabody 6[65 aa] A 40.0
/28.4
10
/10
OPRM_MOUSE Mu-type opioid receptor
8ef5[4] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 29.2
/28.4
24
/24
OPRM_HUMAN Mu-type opioid receptor
8f7q[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 30.4
/28.4
23
/23
OPRM_HUMAN Mu-type opioid receptor
8f7q[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. G 0.0
/28.4
1
/1
OPRM_HUMAN Mu-type opioid receptor
8efl[1] G GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. F 31.2
/28.4
16
/16
OPRM_HUMAN Mu-type opioid receptor
8efo[1] G GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. F 35.0
/28.4
20
/20
OPRM_HUMAN Mu-type opioid receptor
8f7q[2] B COLI_HUMAN Beta-endorphin[21 aa] A 29.4
/28.4
17
/17
OPRM_HUMAN Mu-type opioid receptor
8f7r[2] B endomorphin[5 aa] A 23.5
/28.4
17
/17
OPRM_HUMAN Mu-type opioid receptor
8f7r[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 28.6
/28.4
21
/21
OPRM_HUMAN Mu-type opioid receptor
8f7r[1] I GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. G 33.3
/28.4
18
/18
OPRM_HUMAN Mu-type opioid receptor
6dde[6] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 38.1
/28.8
21
/22
OPRM_MOUSE Mu-type opioid receptor
7sbf[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 38.9
/29.0
18
/21
C562_ECOLX OPRM_MOUSE Soluble cytochrome b562, Mu-type opioid receptor c..
7y1f[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. C 60.0
/28.4
10
/24
OPRK_HUMAN Kappa-type opioid receptor
7y1f[1] B Dynorphin[9 aa] C 30.8
/28.4
13
/24
OPRK_HUMAN Kappa-type opioid receptor
8efb[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 25.0
/28.4
24
/24
OPRM_HUMAN Mu-type opioid receptor
8f7w[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 44.4
/28.4
9
/20
OPRK_HUMAN Kappa-type opioid receptor
8f7w[1] B PDYN_HUMAN Dynorphin[8 aa] A 36.4
/28.4
11
/20
OPRK_HUMAN Kappa-type opioid receptor
6wjc[1] B 3SIM7_DENAN Muscarinic toxin 7[69 aa] A 0.0
/28.3
18
/23
ACM1_HUMAN D9IEF7_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin fus..
8ef5[1] G GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. F 31.6
/28.3
19
/19
OPRM_HUMAN Mu-type opioid receptor
8qot[1] B Nanobody E (NbE)[125 aa] A 15.0
/28.3
20
/20
OPRM_MOUSE Mu-type opioid receptor
7vug[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 55.6
/28.2
9
/22
XYNA_BACCI GP139_HUMAN Chimera of Endo-1,4-beta-xylanase and Probable G-p..
7vla[2] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 28.6
/27.1
14
/14
CCR1_HUMAN C-C chemokine receptor type 1
7wic[2] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. B 52.9
/27.2
17
/19
SSR2_HUMAN Somatostatin receptor type 2
5c1m[2] B Nanobody 39[118 aa] A 33.3
/28.1
21
/23
OPRM_MOUSE Mu-type opioid receptor
6b73[2] D Nanobody[122 aa] A 46.2
/28.9
13
/21
C562_ECOLX OPRK_HUMAN Soluble cytochrome b562, kappa-type opioid recepto..
7yit[1] B Nanobody39[109 aa] A 55.6
/28.9
9
/16
OPRK_HUMAN Kappa-type opioid receptor
3sn6[1] B GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. D 50.0
/26.1
2
/2
ENLYS_BPT4 ADRB2_HUMAN Endolysin,Beta-2 adrenergic receptor
6ni3[3] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. D 100.0
/26.1
1
/1
A0A097J809_BPT4 ADRB2_HUMAN Endolysin,Beta-2 adrenergic receptor chimera
6oik[10] C GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 0.0
/29.8
1
/1
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,Muscarinic ac..
6omm[7] D GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 50.0
/29.8
2
/2
FPR2_HUMAN N-formyl peptide receptor 2
6osa[1] D GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 0.0
/24.4
2
/2
NTR1_HUMAN Neurotensin receptor type 1
6oya[1] B GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/21.0
1
/1
OPSD_BOVIN Rhodopsin
6vms[3] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/26.5
3
/3
D9IEF7_BPT4 DRD2_HUMAN DRD2_HUMAN Endolysin,D(2) dopamine receptor,D(2) dopamine rec..
7bb6[2] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 50.0
/55.5
4
/4
V2R_HUMAN Vasopressin V2 receptor
7bz2[2] B GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 100.0
/24.7
1
/1
Beta2 adrenergic receptor
7db6[6] B Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/32.7
4
/4
MTR1A_HUMAN Melatonin receptor type 1A
7dh5[4] B GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 50.0
/36.6
2
/2
ADRB3_CANLF Beta-3 adrenergic receptor
7f1r[1] C GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 100.0
/28.6
1
/1
CCL5_HUMAN CCR5_HUMAN C-C motif chemokine 5,C-C chemokine receptor type ..
7f8v[1] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/33.3
1
/1
GASR_HUMAN Gastrin/cholecystokinin type B receptor
7jjo[4] A GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 50.0
/31.5
2
/2
Beta1-Adrenergic Receptor
7mbx[6] B GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. F 0.0
/33.7
1
/1
CCKAR_HUMAN Cholecystokinin receptor type A
7t2g[1] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. D 0.0
/28.5
1
/1
C562_ECOLX OPRM_MOUSE Soluble cytochrome b562,Mu-type opioid receptor
7t6s[3] B GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 50.0
/29.8
2
/2
FPR2_HUMAN N-formyl peptide receptor 2
7vug[4] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. D 50.0
/28.2
2
/3
XYNA_BACCI GP139_HUMAN Chimera of Endo-1,4-beta-xylanase and Probable G-p..
7w0m[3] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. D 100.0
/30.1
1
/2
C562_ECOLX APJ_HUMAN Soluble cytochrome b562,Apelin receptor
7w55[2] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. F 0.0
/26.7
1
/1
Neuromedin-U receptor 2
7wj5[1] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/27.2
2
/2
C562_ECOLX SSR2_HUMAN Soluble cytochrome b562,Somatostatin receptor type..
7wq3[2] C GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 100.0
/28.2
1
/2
GALR1_HUMAN Galanin receptor type 1
7wq4[4] D GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 0.0
/33.2
1
/1
GALR2_HUMAN Galanin receptor type 2
7wvw[2] D GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. B 100.0
/30.9
1
/1
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
7x9b[1] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. D 0.0
/26.1
1
/1
NPY2R_HUMAN Neuropeptide Y receptor type 2
7xav[1] C GBB1_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. A 0.0
/27.8
1
/1
SSR2_HUMAN Somatostatin receptor type 2,LargeBit
7xk8[1] D GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. B 0.0
/27.1
1
/1
NMUR2_HUMAN Neuromedin-U receptor 2
7xtc[1] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/28.6
2
/2
C562_ECOLX 5HT7R_HUMAN Soluble cytochrome b562,5-hydroxytryptamine recept..
7y89[2] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/31.0
1
/1
GPR17_HUMAN Uracil nucleotide/cysteinyl leukotriene receptor
7ykd[1] D GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. B 100.0
/24.7
1
/3
CML1_HUMAN Chemerin-like receptor 1
8i95[6] B GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) .. E 0.0
/32.9
1
/1
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
5vbl[1] A agonist peptide[17 aa] B 15.0
/27.9
20
/26
APJ_HUMAN RUBR_CLOPA APJ_HUMAN Apelin receptor,Rubredoxin,Apelin receptor Chimera..
6knm[1] B Single domain antibody JN241[129 aa] A 12.0
/27.9
25
/32
APJ_HUMAN RUBR_CLOPA APJ_HUMAN Apelin receptor,Rubredoxin,Apelin receptor
7xa3[1] B CCL2_HUMAN C-C motif chemokine 2[69 aa] A 22.2
/27.8
18
/26
CCR2_HUMAN Isoform B of C-C chemokine receptor type 2
7xa3[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 38.5
/27.8
13
/17
CCR2_HUMAN Isoform B of C-C chemokine receptor type 2
7y24[2] E Octreotide[8 aa] F 33.3
/28.2
18
/18
SSR2_HUMAN Somatostatin receptor type 2
7xat[3] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 36.8
/27.2
19
/22
SSR2_HUMAN Somatostatin receptor type 2,LargeBit
7xau[1] F Octreotide[7 aa] A 36.8
/27.8
19
/19
SSR2_HUMAN Somatostatin receptor type 2,LargeBit
7xav[1] F Lanreotide[6 aa] A 33.3
/27.8
15
/15
SSR2_HUMAN Somatostatin receptor type 2,LargeBit
6tko[1] B ARRB1_HUMAN Beta-arrestin-1[344 aa] A 36.0
/30.3
25
/42
ADRB1_MELGA Beta-1 adrenergic receptor
6u1n[1] B ARRB1_RAT Beta-arrestin-1[359 aa] A 33.3
/29.8
3
/16
ACM2_HUMAN V2R_HUMAN Muscarinic acetylcholine receptor M2, Vasopressin ..
7r0c[1] C ARRB1_HUMAN Arrestin2[353 aa] A 33.3
/53.8
15
/24
V2R_HUMAN Vasopressin V2 receptor
7srs[1] D ARRB1_HUMAN Isoform 1B of Beta-arrestin-1[355 aa] C 33.3
/27.7
15
/22
5-hydroxytryptamine receptor 2B
7srs[1] A Anti-5HT2BR Fab light chain[107 aa] C 0.0
/27.7
4
/4
5-hydroxytryptamine receptor 2B
7srs[1] B Anti-5HT2BR Fab heavy chain[127 aa] C 12.5
/27.7
8
/9
5-hydroxytryptamine receptor 2B
7t10[2] B GNAI3_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 36.4
/28.5
11
/13
SSR2_HUMAN OPRK_HUMAN SSR2_HUMAN Somatostatin receptor type 2,Kappa-type opioid rec..
7ul5[1] B Nanobody 6[86 aa] A 36.4
/27.5
11
/11
SSR2_HUMAN OPRK_HUMAN SSR2_HUMAN Somatostatin receptor type 2
5tud[2] B Anti-5-HT2B Fab light chain[211 aa] A 0.0
/27.5
5
/5
5HT2B_HUMAN C562_ECOLX 5HT2B_HUMAN 5-hydroxytryptamine receptor 2B,Soluble cytochrome..
5tud[2] C Anti-5-HT2B Fab heavy chain[229 aa] A 14.3
/27.5
14
/18
5HT2B_HUMAN C562_ECOLX 5HT2B_HUMAN 5-hydroxytryptamine receptor 2B,Soluble cytochrome..
7y27[1] F somatostatin-14[12 aa] D 30.8
/27.5
13
/13
SSR2_HUMAN Somatostatin receptor type 2
7w57[1] A Guanine nucleotide-binding protein G(q) subunit al.. F 25.0
/27.4
20
/25
Neuromedin-U receptor 2
7w57[1] C NMS_HUMAN Neuromedin-S[12 aa] F 11.5
/27.4
26
/29
Neuromedin-U receptor 2
8hn1[1] A 3SI1A_DENAN Toxin AdTx1[65 aa] B 4.5
/27.3
22
/22
ADA1A_HUMAN Alpha-1A adrenergic receptor
7t10[1] E SMS_HUMAN Somatostatin-14[14 aa] A 38.1
/28.5
21
/21
SSR2_HUMAN OPRK_HUMAN SSR2_HUMAN Somatostatin receptor type 2,Kappa-type opioid rec..
7wic[1] A somatostatin-14[14 aa] B 34.8
/27.2
23
/23
SSR2_HUMAN Somatostatin receptor type 2
7xmr[1] E SMS_HUMAN Somatostatin-14[14 aa] A 30.8
/27.2
26
/26
SSR2_HUMAN Somatostatin receptor type 2
7t11[1] E Octreotide[8 aa] F 23.8
/27.6
21
/21
SSR2_HUMAN OPRK_HUMAN SSR2_HUMAN Somatostatin receptor type 2,Kappa-type opioid rec..
7yae[1] F DPN-CYS-PHE-DTR-LYS-THR-CYS-THO[8 aa] E 25.0
/27.2
16
/16
SSR2_HUMAN Somatostatin receptor type 2
7xmr[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 35.3
/27.2
17
/19
SSR2_HUMAN Somatostatin receptor type 2
7yac[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 37.5
/27.2
16
/19
SSR2_HUMAN Somatostatin receptor type 2
7yae[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 43.8
/27.2
16
/19
SSR2_HUMAN Somatostatin receptor type 2
7vl8[2] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 21.1
/27.1
19
/19
CCR1_HUMAN C-C chemokine receptor type 1
7vl9[2] D CCL15_HUMAN CCL15(26-92)[65 aa] E 12.5
/27.1
24
/35
CCR1_HUMAN C-C chemokine receptor type 1
7xk8[1] A NMU_HUMAN Neuromedin-U-25[26 aa] B 14.3
/27.1
21
/24
NMUR2_HUMAN Neuromedin-U receptor 2
7xk8[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. B 38.5
/27.1
13
/16
NMUR2_HUMAN Neuromedin-U receptor 2
6do1[1] E Nanobody Nb.AT110i1[58 aa] A 0.0
/26.9
3
/3
AGTR1_HUMAN C562_ECOLX AGTR1_HUMAN Type-1 angiotensin II receptor,Soluble cytochrome ..
6jod[1] B Angiotensin II[8 aa] A 36.8
/34.3
19
/24
AGTR2_HUMAN Type-2 angiotensin II receptor
6os0[1] C ANGT_HUMAN Angiotensinogen[8 aa] A 28.6
/26.9
7
/26
AGTR1_HUMAN C562_ECOLX AGTR1_HUMAN Type-1 angiotensin II receptor,Soluble cytochrome ..
4rws[1] B VMI2_HHV8P Viral macrophage inflammatory protein 2[70 aa] A 23.5
/26.9
17
/26
CXCR4_HUMAN LYS_BPT4 CXCR4_HUMAN C-X-C chemokine receptor type 4/Endolysin chimeric..
7yon[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 30.8
/26.8
13
/14
NPY2R_HUMAN Neuropeptide Y receptor type 2
7yon[1] D PYY_HUMAN Peptide YY(3-36)[25 aa] E 33.3
/26.8
21
/23
NPY2R_HUMAN Neuropeptide Y receptor type 2
7yoo[1] D NPY_HUMAN Neuropeptide Y[29 aa] E 29.2
/26.8
24
/28
NPY2R_HUMAN Neuropeptide Y receptor type 2
7w55[1] C NMU_HUMAN Neuromedin-U-25[9 aa] F 12.0
/26.7
25
/27
Neuromedin-U receptor 2
6vms[1] A GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit al.. E 38.1
/26.5
21
/22
D9IEF7_BPT4 DRD2_HUMAN DRD2_HUMAN Endolysin,D(2) dopamine receptor,D(2) dopamine rec..
7tuz[1] B GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 42.1
/26.3
19
/23
GP183_HUMAN G-protein coupled receptor 183
7x9a[1] E NPY_HUMAN Neuropeptide Y[36 aa] A 14.3
/24.5
35
/42
NPY1R_HUMAN Neuropeptide Y receptor type 1
7x9b[1] E NPY_HUMAN Neuropeptide Y[36 aa] D 31.8
/26.1
22
/22
NPY2R_HUMAN Neuropeptide Y receptor type 2
7x9b[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 38.9
/26.1
18
/20
NPY2R_HUMAN Neuropeptide Y receptor type 2
3sn6[1] A GNAS2_BOVIN Guanine nucleotide-binding protein G(s) subunit al.. D 34.8
/26.1
23
/25
ENLYS_BPT4 ADRB2_HUMAN Endolysin,Beta-2 adrenergic receptor
7vgx[1] B NPY_HUMAN Neuropeptide Y[22 aa] A 16.7
/25.9
24
/26
NPY1R_HUMAN Neuropeptide Y receptor type 1
7vgx[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 33.3
/25.9
12
/14
NPY1R_HUMAN Neuropeptide Y receptor type 1
8xbh[1] A GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 27.3
/25.7
22
/23
GPR34_HUMAN Probable G-protein coupled receptor 34
4lde[5] B Camelid Antibody Fragment[120 aa] A 35.3
/25.1
17
/20
LYS_BPT4 ADRB2_HUMAN ADRB2_HUMAN Lysozyme, Beta-2 adrenergic receptor
6h7l[8] C Camelid antibody fragment Nb6B9[120 aa] B 33.3
/32.0
24
/27
ADRB1_MELGA Beta-1 adrenergic receptor
7bts[2] B Camelid Antibody Fragment[120 aa] A 35.7
/26.6
14
/17
D9IEF7_BPT4 Lysozyme-Beta-1 adrenergic receptor chimera
5jqh[2] D Nanobody60, Nb60[120 aa] A 25.0
/25.1
20
/25
ENLYS_BPT4 ADRB2_HUMAN Endolysin,Beta-2 adrenergic receptor
6mxt[1] B nanobody Nb71[122 aa] A 26.3
/25.3
19
/25
D9IEF7_BPT4 ADRB2_HUMAN ADRB2_HUMAN Endolysin, Beta-2 adrenergic receptor chimera
4gbr[1] B LYS_BPT4 Lysozyme[162 aa] A 20.0
/25.2
5
/7
ADRB2_HUMAN Beta-2 adrenergic receptor
7xna[1] B CYN 154806[10 aa] A 0.0
/25.1
10
/23
SSR2_HUMAN XYNA_BACCI SSR2_HUMAN Somatostatin receptor type 2,Endo-1,4-beta-xylanas..
7ykd[1] A RARR2_HUMAN Retinoic acid receptor responder protein 2[9 aa] B 28.6
/24.7
14
/23
CML1_HUMAN Chemerin-like receptor 1
8sg1[1] E Chemerin 9[9 aa] A 30.0
/24.7
10
/18
CML1_HUMAN Chemerin-like receptor 1
8sg1[1] D GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 29.4
/24.7
17
/23
CML1_HUMAN Chemerin-like receptor 1
7bz2[1] A GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. E 31.2
/24.7
16
/18
Beta2 adrenergic receptor
7dhr[1] A GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. E 31.6
/24.7
19
/19
ADRB2_HUMAN Beta-2 adrenergic receptor
6osa[1] B JMV449[6 aa] A 7.7
/24.4
13
/18
NTR1_HUMAN Neurotensin receptor type 1
6osa[1] C GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. A 31.6
/24.4
19
/21
NTR1_HUMAN Neurotensin receptor type 1
2ksa[1] B TKN1_HUMAN Substance P[11 aa] A 0.0
/23.6
2
/7
NK1R_HUMAN Substance-P receptor
2ksb[1] B TKN1_HUMAN Substance P[11 aa] A 20.0
/23.6
5
/12
NK1R_HUMAN Substance-P receptor
8u26[1] F TKN1_HUMAN Protachykinin-1[11 aa] E 30.0
/23.6
10
/21
NK1R_HUMAN Substance-P receptor
6wha[1] B G subunit q (Gi2-mini-Gq chimeric)[211 aa] A 37.5
/30.3
16
/17
C562_ECOLX 5HT2A_HUMAN Soluble cytochrome b562,5-hydroxytryptamine recept..
7dh5[3] A GNAS2_HUMAN GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. E 75.0
/36.6
8
/20
ADRB3_CANLF Beta-3 adrenergic receptor
7l1u[2] A Engineered Guanine nucleotide-binding protein subu.. E 46.2
/29.2
13
/16
Q548Y0_HUMAN Hypocretin receptor type 2
7mby[3] E GNAI1_HUMAN GNAS2_HUMAN GNAS2_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. D 40.0
/33.7
15
/16
CCKAR_HUMAN Cholecystokinin receptor type A
7p00[2] D GNAI1_HUMAN A0A590UJY2_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 35.7
/23.6
14
/22
NK1R_HUMAN Substance-P receptor
7ran[1] B G protein subunit q (Gi2-mini-Gq chimera)[232 aa] A 40.0
/28.4
15
/15
5HT2A_HUMAN 5-hydroxytryptamine receptor 2A
7ryc[1] C Guanine nucleotide-binding protein G(I)/G(S)/G(O) .. B 75.0
/63.9
12
/12
OXYR_HUMAN Oxytocin receptor
7sr8[1] A a modified Guanine nucleotide-binding protein G(q).. E 50.0
/29.2
14
/19
Q548Y0_HUMAN Hypocretin receptor type 2
7srr[1] A G protein subunit q (Gi2-mini-Gq chimera)[225 aa] E 36.4
/29.8
11
/19
5HT2B_HUMAN 5-hydroxytryptamine receptor 2B
7vuh[3] A GNAS2-2_HUMAN GNAS2-2_HUMAN Isoform Gnas-2 of Guanine nucleotide-binding prote.. E 54.5
/28.2
11
/23
XYNA_BACCI GP139_HUMAN chimera of Endo-1,4-beta-xylanase and Probable G-p..
7x1t[3] C mini-G alpha q protein[218 aa] B 27.3
/30.8
11
/22
TRFR_HUMAN Thyrotropin-releasing hormone receptor
7y26[2] B Engineered Guanine nucleotide-binding protein G(q).. E 44.4
/27.8
9
/13
SSR2_HUMAN Somatostatin receptor type 2
8thk[2] A GNAI2_HUMAN GNAS2_HUMAN GNAQ_HUMAN Guanine nucleotide-binding protein G(i) subunit al.. E 42.9
/27.9
14
/15
ENLYS_BPT4 ADA1A_HUMAN Endolysin,Alpha-1A adrenergic receptor
7p00[1] F Substance P[12 aa] E 18.8
/23.6
16
/28
NK1R_HUMAN Substance-P receptor
7rmg[2] C TKN1_HUMAN Substance P[12 aa] B 21.4
/23.4
14
/23
NK1R_HUMAN Substance-P receptor
7p02[1] F TKN1_HUMAN Protachykinin-1[10 aa] E 13.3
/23.6
15
/26
NK1R_HUMAN Substance-P receptor
7rmg[2] A GNAS2_HUMAN GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit al.. B 36.4
/23.4
11
/17
NK1R_HUMAN Substance-P receptor
7rmi[1] C Substance P 6-11[7 aa] B 14.3
/23.6
14
/22
NK1R_HUMAN Substance-P receptor
3dqb[1] B GNAT1_BOVIN 11meric peptide form Guanine nucleotide-binding pr.. A 40.0
/21.0
15
/15
OPSD_BOVIN Rhodopsin
3pqr[9] B GNAT1_BOVIN Guanine nucleotide-binding protein G(t) subunit al.. A 42.9
/21.0
14
/14
OPSD_BOVIN Rhodopsin
4pxf[2] B ARRS_BOVIN S-arrestin[7 aa] A 28.6
/21.0
7
/7
OPSD_BOVIN Rhodopsin
4x1h[1] B C-terminal derived peptide of guanine nucleotide-b.. A 46.2
/21.0
13
/13
OPSD_BOVIN Rhodopsin
6oy9[1] A GNAT1_BOVIN Gt-alpha/Gi1-alpha chimera[223 aa] D 36.8
/21.0
19
/19
OPSD_BOVIN Rhodopsin
6oya[1] A GNAT1_BOVIN Gt-alpha/Gi1-alpha chimera[205 aa] E 27.8
/21.0
18
/18
OPSD_BOVIN Rhodopsin
7mt8[4] A GRK1_BOVIN Rhodopsin kinase GRK1[346 aa] B 22.6
/21.0
31
/31
OPSD_BOVIN Rhodopsin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
424 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6tpk[1] B NU2
(3~{R},6~{R})-6-[(2~{S})-butan-2-yl]-3-(2,3-dihydr..
A 76.9
/62.9
13
/13
OXYR_HUMAN Oxytocin receptor
2y03[2] G 5FW
ISOPRENALINE[15 atoms]
A 33.3
/32.0
12
/12
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
6h7j[2] G 5FW
ISOPRENALINE[15 atoms]
B 28.6
/32.0
14
/14
ADRB1_MELGA Beta-1 adrenergic receptor
7dhr[1] F 5FW
ISOPRENALINE[15 atoms]
E 25.0
/24.7
8
/8
ADRB2_HUMAN Beta-2 adrenergic receptor
7jjo[3] F 5FW
ISOPRENALINE[15 atoms]
E 27.3
/31.5
11
/11
Beta1-Adrenergic Receptor
7xjh[1] F 5FW
ISOPRENALINE[15 atoms]
E 0.0
/36.6
4
/12
ADRB3_CANLF Beta-3 adrenergic receptor
7dh5[1] F H6U
2-(2-azanyl-1,3-thiazol-4-yl)-N-[4-[2-[[(2R)-2-oxi..
E 0.0
/36.6
4
/17
ADRB3_CANLF Beta-3 adrenergic receptor
7xji[1] F EI5
3-[3-[2-[[(2~{S})-2-(3-chlorophenyl)-2-oxidanyl-et..
D 33.3
/36.6
3
/14
ADRB3_CANLF Beta-3 adrenergic receptor
7f9y[1] G OCA
OCTANOIC ACID (CAPRYLIC ACID)[9 atoms]
F 16.7
/35.3
6
/7
Soluble cytochrome b562
6tp3[2] C NS2
[(2~{S})-2-(6-chloranyl-7-methyl-1~{H}-benzimidazo..
A 17.6
/28.2
17
/17
OX1R_HUMAN Orexin receptor type 1
6tq7[4] C NVK
1-(2-methyl-1,3-benzoxazol-6-yl)-3-(1,5-naphthyrid..
A 15.4
/29.1
13
/13
OX1R_HUMAN Orexin receptor type 1
5unf[3] C 8ES
N-benzyl-N-(2-ethyl-4-oxo-3-{[2'-(2H-tetrazol-5-yl..
A 38.5
/34.7
13
/20
C562_ECOLX AGTR2_HUMAN Chimera protein of Type-2 angiotensin II receptor ..
7jni[2] C VFD
Olodanrigan[38 atoms]
A 38.5
/34.3
13
/17
C562_ECOLX AGTR2_HUMAN Soluble cytochrome b562,Type-2 angiotensin II rece..
7jni[1] K HEZ
HEXANE-1,6-DIOL[8 atoms]
A 100.0
/34.3
2
/5
C562_ECOLX AGTR2_HUMAN Soluble cytochrome b562,Type-2 angiotensin II rece..
5unh[2] C 8EM
N-[(furan-2-yl)methyl]-N-(4-oxo-2-propyl-3-{[2'-(2..
A 37.5
/33.3
16
/23
C562_ECOLX AGTR2_HUMAN Soluble cytochrome b562,Type-2 angiotensin II rece..
7na8[1] F 1KD
1-(methanesulfonyl)-1'-(2-methyl-L-alanyl-O-benzyl..
E 33.3
/34.0
12
/19
GHSR_HUMAN Growth hormone secretagogue receptor type 1
4ea3[4] C 0NN
1-benzyl-N-[3-(1'H,3H-spiro[2-benzofuran-1,4'-pipe..
A 43.8
/30.9
16
/16
C562_ECOLX OPRX_HUMAN Fusion protein of Nociceptin receptor and cytochro..
5dhg[4] C DGV
1-benzyl-N-{3-[4-(2,6-dichlorophenyl)piperidin-1-y..
A 46.2
/29.8
13
/14
C562_ECOLX OPRX_HUMAN Soluble cytochrome b562,Nociceptin receptor
6ko5[1] D 8QX
6-(4-bromanyl-2-fluoranyl-phenoxy)-2-methyl-3-[[(3..
A 11.1
/33.8
9
/16
C562_ECOLX GHSR_HUMAN Chimera of Soluble cytochrome b562 and Growth horm..
2y00[10] C Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 0.0
/32.3
8
/8
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
2y00[12] D Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 44.4
/32.3
9
/9
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
2y00[14] L Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 40.0
/32.3
5
/5
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
4xnv[1] D Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 11.1
/24.5
9
/10
P2RY1_HUMAN RUBR_CLOPA P2RY1_HUMAN P2Y purinoceptor 1, Rubredoxin, P2Y purinoceptor 1..
4xnv[1] E Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 16.7
/24.5
12
/12
P2RY1_HUMAN RUBR_CLOPA P2RY1_HUMAN P2Y purinoceptor 1, Rubredoxin, P2Y purinoceptor 1..
4xnv[1] F Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 40.0
/24.5
5
/10
P2RY1_HUMAN RUBR_CLOPA P2RY1_HUMAN P2Y purinoceptor 1, Rubredoxin, P2Y purinoceptor 1..
5cxv[1] D Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 22.2
/28.9
9
/9
ACM1_HUMAN ENLYS_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin,Mus..
6wjc[1] D Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 0.0
/28.3
3
/5
ACM1_HUMAN D9IEF7_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin fus..
6wjc[1] E Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 100.0
/28.3
1
/10
ACM1_HUMAN D9IEF7_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin fus..
6wjc[1] F Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 50.0
/28.3
6
/6
ACM1_HUMAN D9IEF7_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin fus..
6wjc[1] G Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
A 33.3
/28.3
6
/6
ACM1_HUMAN D9IEF7_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin fus..
7mbx[2] G Y01
CHOLESTEROL HEMISUCCINATE[35 atoms]
F 50.0
/33.7
6
/7
CCKAR_HUMAN Cholecystokinin receptor type A
7xov[1] F IA1
2-[2-[[4-(4-chloranyl-2,5-dimethoxy-phenyl)-5-(2-c..
E 5.6
/33.7
18
/23
CCKAR_HUMAN Cholecystokinin receptor type A
7ul3[1] E FO9
famotidine[20 atoms]
A 33.3
/33.3
3
/12
HRH2_HUMAN A0A8B8VNB6_BALMU HRH2_HUMAN Histamine H2 receptor
7f8u[1] B 1OE
2-[2-[[4-(2-chlorophenyl)-1,3-thiazol-2-yl]carbamo..
A 8.3
/33.0
12
/13
CCKAR_HUMAN ENLYS_BPT4 CCKAR_HUMAN Fusion protein of Cholecystokinin receptor type A ..
7f8y[1] B 1OZ
N-[(3S)-1-methyl-2-oxidanylidene-5-phenyl-3H-1,4-b..
A 8.3
/33.0
12
/14
CCKAR_HUMAN ENLYS_BPT4 CCKAR_HUMAN fusion protein of Cholecystokinin receptor type A ..
4ej4[1] B EJ4
(4bS,8R,8aS,14bR)-7-(cyclopropylmethyl)-5,6,7,8,14..
A 20.0
/32.5
5
/12
OPRD_MOUSE LYS_BPT4 OPRD_MOUSE Delta-type opioid receptor, Lysozyme chimera
4n6h[1] T EJ4
(4bS,8R,8aS,14bR)-7-(cyclopropylmethyl)-5,6,7,8,14..
A 41.7
/32.4
12
/13
C562_ECOLX OPRD_HUMAN Soluble cytochrome b562, Delta-type opioid recepto..
3pbl[1] E ETQ
3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]m..
A 30.0
/32.2
10
/14
DRD3_HUMAN LYS_BPT4 DRD3_HUMAN D(3) dopamine receptor, Lysozyme chimera
4zjc[1] B 4OT
[5-(2-fluorophenyl)-2-methyl-1,3-thiazol-4-yl]{(2S..
A 8.3
/32.0
12
/16
OX1R_HUMAN Q9V2J8_PYRAB OX1R_HUMAN human OX1R fusion protein to P.abysii glycogen syn..
4ami[2] C G90
2-[(2S)-3-[[1-(1H-indol-3-yl)-2-methyl-propan-2-yl..
A 37.5
/32.0
16
/18
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
2vt4[4] J D10
DECANE[10 atoms]
A 0.0
/31.7
2
/2
ADRB1_MELGA BETA1 ADRENERGIC RECEPTOR
6h7n[2] G FVK
~{N}-[2-[[(2~{S})-2-oxidanyl-3-(4-oxidanylphenoxy)..
B 29.4
/32.0
17
/17
ADRB1_MELGA Beta-1 adrenergic receptor
6me9[2] C JEV
N-{2-[(8S)-1,6,7,8-tetrahydro-2H-indeno[5,4-b]fura..
A 8.3
/28.8
12
/16
C562_ECOLX MTR1B_HUMAN RUBR_CLOPA MTR1B_HUMAN Soluble cytochrome b562,Melatonin receptor type 1B..
7db6[1] F JEV
N-{2-[(8S)-1,6,7,8-tetrahydro-2H-indeno[5,4-b]fura..
E 0.0
/32.7
4
/12
MTR1A_HUMAN Melatonin receptor type 1A
7vgz[1] F JEV
N-{2-[(8S)-1,6,7,8-tetrahydro-2H-indeno[5,4-b]fura..
A 0.0
/33.0
4
/14
MTR1A_HUMAN Melatonin receptor type 1A
7vh0[1] F JEV
N-{2-[(8S)-1,6,7,8-tetrahydro-2H-indeno[5,4-b]fura..
A 8.3
/31.6
12
/12
MTR1B_HUMAN Melatonin receptor type 1B
5dhh[3] H DGW
(5S,7S)-7-{[4-(2,6-dichlorophenyl)piperidin-1-yl]m..
A 33.3
/30.8
15
/16
C562_ECOLX OPRX_HUMAN Soluble cytochrome b562,Nociceptin receptor
2y02[2] J WHJ
CARMOTEROL[27 atoms]
A 31.2
/32.3
16
/17
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
3zpq[2] I XF5
4-(PIPERAZIN-1-YL)-1H-INDOLE[15 atoms]
A 55.6
/32.3
9
/9
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
3zpr[2] G 3WC
4-METHYL-2-(PIPERAZIN-1-YL) QUINOLINE[17 atoms]
A 40.0
/31.8
15
/15
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
2vt4[11] E P32
4-{[(2S)-3-(tert-butylamino)-2-hydroxypropyl]oxy}-..
A 35.3
/31.7
17
/17
ADRB1_MELGA BETA1 ADRENERGIC RECEPTOR
6h7o[2] G P32
4-{[(2S)-3-(tert-butylamino)-2-hydroxypropyl]oxy}-..
B 35.3
/32.0
17
/17
ADRB1_MELGA Beta-1 adrenergic receptor
8dcs[1] F P32
4-{[(2S)-3-(tert-butylamino)-2-hydroxypropyl]oxy}-..
E 23.5
/31.5
17
/17
ENLYS_BPT4 Endolysin,Endolysin,Beta-1 adrenergic receptor chi..
2y00[4] J Y00
DOBUTAMINE[22 atoms]
A 35.3
/32.3
17
/17
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
6h7l[2] M Y00
DOBUTAMINE[22 atoms]
B 27.8
/32.0
18
/18
ADRB1_MELGA Beta-1 adrenergic receptor
8dcr[1] F Y00
DOBUTAMINE[22 atoms]
E 22.2
/31.5
18
/18
ENLYS_BPT4 Endolysin,Endolysin,Beta-1 adrenergic receptor chi..
6pt3[2] C OWY
4-[(R)-[(2S,5R)-4-benzyl-2,5-dimethylpiperazin-1-y..
A 47.1
/31.5
17
/18
Delta opioid receptor
6rz6[1] B KNW
(2~{S})-8-[[4-[4-(2-chloranyl-5-fluoranyl-phenyl)b..
A 7.1
/31.3
14
/22
CLTR2_HUMAN C562_ECOLX CLTR2_HUMAN Cysteinyl leukotriene receptor 2,Soluble cytochrom..
7f83[2] E 1KQ
2-(2-methylimidazo[2,1-b][1,3]thiazol-6-yl)-1-[2-[..
A 30.0
/32.6
10
/19
GHSR_HUMAN C562_ECOLX GHSR_HUMAN Growth hormone secretagogue receptor type 1,Solubl..
7xmt[1] F I8B
(2~{S})-2-[[(2~{S})-4-azanyl-2-[(4-methylnaphthale..
A 40.0
/31.2
15
/15
SSR4_HUMAN Somatostatin receptor type 4
6rz9[1] B KO5
(2~{S})-8-[[4-[4-(5-fluoranyl-2-methyl-phenyl)buto..
A 7.1
/31.1
14
/19
CLTR2_HUMAN C562_ECOLX CLTR2_HUMAN Cysteinyl leukotriene receptor 2,Soluble cytochrom..
7b6w[1] B T0B
[(4~{a}~{R},8~{a}~{S})-4-(4-azanyl-6,7-dimethoxy-q..
A 33.3
/31.1
18
/18
Alpha-1B adrenergic receptor,alpha1B adrenergic re..
2ycz[2] C I32
4-{[(2S)-3-(tert-butylamino)-2-hydroxypropyl]oxy}-..
A 40.0
/31.0
15
/15
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
4bvn[2] E MHA
(CARBAMOYLMETHYL-CARBOXYMETHYL-AMINO)-ACETIC ACID[..
A 0.0
/30.4
2
/3
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
5a8e[1] D XTK
4-[(2S)-3-(tert-butylamino)-2-hydroxypropoxy]-7-me..
A 35.3
/30.8
17
/17
ADRB1_MELGA BETA1 ADRENERGIC RECEPTOR
6me3[2] B JEY
N-[2-(5-methoxy-2-phenyl-1H-indol-3-yl)ethyl]aceta..
A 0.0
/30.6
6
/16
MTR1A_HUMAN Q9V2J8_PYRAB MTR1A_HUMAN chimera protein of Melatonin receptor type 1A and ..
6me6[6] C JEY
N-[2-(5-methoxy-2-phenyl-1H-indol-3-yl)ethyl]aceta..
A 6.7
/28.8
15
/19
C562_ECOLX MTR1B_HUMAN RUBR_CLOPA MTR1B_HUMAN Soluble cytochrome b562,Melatonin receptor type 1B..
6me4[1] B ML2
N-[2-(2-iodo-5-methoxy-1H-indol-3-yl)ethyl]acetami..
A 0.0
/30.6
6
/14
MTR1A_HUMAN Q9V2J8_PYRAB MTR1A_HUMAN chimera protein of Melatonin receptor type 1A and ..
6me5[1] B AWY
~{N}-[2-(7-methoxynaphthalen-1-yl)ethyl]ethanamide..
A 0.0
/30.6
4
/12
MTR1A_HUMAN Q9V2J8_PYRAB MTR1A_HUMAN chimera protein of Melatonin receptor type 1A and ..
6wha[1] F U0G
4-(2-{[(2-hydroxyphenyl)methyl]amino}ethyl)-2,5-di..
A 37.5
/30.3
8
/9
C562_ECOLX 5HT2A_HUMAN Soluble cytochrome b562,5-hydroxytryptamine recept..
7sus[1] C 8EH
(1R,2S)-N-[4-(2,6-dimethoxyphenyl)-5-(6-methylpyri..
A 13.3
/28.2
15
/16
APJ_HUMAN RUBR_CLOPA APJ_HUMAN Apelin receptor, with Rubredoxin insertion
7w0l[3] G 8EH
(1R,2S)-N-[4-(2,6-dimethoxyphenyl)-5-(6-methylpyri..
D 33.3
/30.1
12
/13
C562_ECOLX APJ_HUMAN Soluble cytochrome b562,Apelin receptor
8kfx[1] F OS9
8-[[3-(2-methoxyphenoxy)phenyl]methyl]-1-(2-phenyl..
D 20.0
/29.9
5
/15
CCR8_HUMAN C-C chemokine receptor type 8,Fusion protein
8kfy[1] F OXF
2-[2-[4-[(3-phenoxyphenyl)methyl]piperazin-1-yl]et..
D 14.3
/29.9
7
/12
CCR8_HUMAN C-C chemokine receptor type 8,Fusion protein
4mqs[2] C IXO
4-(4,5-dihydro-1,2-oxazol-3-yloxy)-N,N,N-trimethyl..
A 12.5
/29.8
8
/14
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2
6oik[1] F IXO
4-(4,5-dihydro-1,2-oxazol-3-yloxy)-N,N,N-trimethyl..
A 14.3
/29.8
7
/13
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,Muscarinic ac..
4mqt[1] D 2CU
3-amino-5-chloro-N-cyclopropyl-4-methyl-6-[2-(4-me..
A 18.2
/31.0
11
/11
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2
6oik[3] G 2CU
3-amino-5-chloro-N-cyclopropyl-4-methyl-6-[2-(4-me..
A 0.0
/29.8
5
/8
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,Muscarinic ac..
6u1n[1] E 2CU
3-amino-5-chloro-N-cyclopropyl-4-methyl-6-[2-(4-me..
A 0.0
/29.8
9
/14
ACM2_HUMAN V2R_HUMAN Muscarinic acetylcholine receptor M2, Vasopressin ..
7t8x[4] F ACH
ACETYLCHOLINE[10 atoms]
A 0.0
/29.8
4
/9
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,muscarinic ac..
7t6s[1] F FUI
N-(4-chlorophenyl)-N'-[1-methyl-3-oxo-2-phenyl-5-(..
E 30.0
/29.8
10
/13
FPR2_HUMAN N-formyl peptide receptor 2
6to7[17] BA PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 10.0
/29.0
10
/10
OX1R_HUMAN Orexin receptor type 1
6tos[4] Z PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
B 31.2
/28.9
16
/17
OX1R_HUMAN Orexin receptor type 1
6tp4[1] C NRZ
(2~{S})-~{N}-(3,5-dimethylphenyl)-1-(4-methoxyphen..
A 15.4
/29.5
13
/13
OX1R_HUMAN Orexin receptor type 1
7br3[1] L F5O
4-[[(1R)-2-[5-(2-fluoranyl-3-methoxy-phenyl)-3-[[2..
A 28.6
/29.5
14
/19
GNRHR_HUMAN Q9V2J8_PYRAB GNRHR_HUMAN Gonadotropin-releasing hormone receptor,GlgA glyco..
8k2w[1] E LPC
[1-MYRISTOYL-GLYCEROL-3-YL]PHOSPHONYLCHOLINE[31 at..
B 12.5
/29.4
8
/8
C562_ECOLX CXCR3_HUMAN OPRK_HUMAN CXCR3_HUMAN Soluble cytochrome b562,C-X-C chemokine receptor t..
8k2w[1] F FI6
N-[(1R)-1-[3-(4-ethoxyphenyl)-4-oxidanylidene-pyri..
B 25.0
/29.4
8
/9
C562_ECOLX CXCR3_HUMAN OPRK_HUMAN CXCR3_HUMAN Soluble cytochrome b562,C-X-C chemokine receptor t..
4s0v[1] B SUV
[(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,..
A 10.5
/27.3
19
/19
OX2R_HUMAN Q9V2J8_PYRAB OX2R_HUMAN Human Orexin receptor type 2 fusion protein to P. ..
4zj8[1] B SUV
[(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,..
A 7.1
/32.0
14
/19
OX1R_HUMAN Q9V2J8_PYRAB OX1R_HUMAN human OX1R fusion protein to P.abysii glycogen syn..
6to7[2] C SUV
[(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,..
A 11.8
/29.0
17
/17
OX1R_HUMAN Orexin receptor type 1
6tpj[2] D SUV
[(7R)-4-(5-chloro-1,3-benzoxazol-2-yl)-7-methyl-1,..
A 10.5
/29.3
19
/19
OX2R_HUMAN Q9V2J8_PYRAB Q548Y0_HUMAN Orexin receptor type 2,GlgA glycogen synthase,Hypo..
6b73[2] E CVV
N-[(5alpha,6beta)-17-(cyclopropylmethyl)-3-hydroxy..
A 50.0
/28.9
8
/15
C562_ECOLX OPRK_HUMAN Soluble cytochrome b562, kappa-type opioid recepto..
8dzr[1] F U9I
methyl (3R)-4-[(3,4-dichlorophenyl)acetyl]-3-[(pyr..
A 57.1
/30.8
7
/11
OPRK_HUMAN Kappa-type opioid receptor
8dzs[1] F U9I
methyl (3R)-4-[(3,4-dichlorophenyl)acetyl]-3-[(pyr..
A 62.5
/29.2
8
/14
OPRK_HUMAN Kappa-type opioid receptor
4dkl[2] B BF0
methyl 4-{[(5beta,6alpha)-17-(cyclopropylmethyl)-3..
A 16.7
/29.2
6
/14
OPRM_MOUSE LYS_BPT4 OPRM_MOUSE Mu-type opioid receptor, lysozyme chimera
3uon[1] B QNB
(3R)-1-azabicyclo[2.2.2]oct-3-yl hydroxy(diphenyl)..
A 18.2
/29.8
11
/17
ACM2_HUMAN LYS_BPT4 ACM2_HUMAN Human M2 muscarinic acetylcholine, receptor T4 lys..
5zk3[1] B QNB
(3R)-1-azabicyclo[2.2.2]oct-3-yl hydroxy(diphenyl)..
A 16.7
/29.2
12
/17
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,Apo-cytochrom..
5yc8[3] B 3C0
N-methyl scopolamine[23 atoms]
A 12.5
/29.2
8
/14
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,Redesigned ap..
5zkb[1] B 82F
N-[2-[(2S)-2-[(dipropylamino)methyl]piperidin-1-yl..
A 16.7
/29.2
12
/19
ACM2_HUMAN ACM2_HUMAN Muscarinic acetylcholine receptor M2,Apo-cytochrom..
7sqo[1] J A6F
methyl (2R,3S)-3-[(methanesulfonyl)amino]-2-({[(1s..
A 25.0
/30.4
8
/14
OX2R_HUMAN Orexin receptor type 2
7sr8[1] F A6F
methyl (2R,3S)-3-[(methanesulfonyl)amino]-2-({[(1s..
E 15.4
/29.2
13
/13
Q548Y0_HUMAN Hypocretin receptor type 2
6tp6[2] C NT5
[(2~{R},5~{R})-5-[(5-fluoranylpyridin-2-yl)oxymeth..
A 11.1
/29.1
18
/18
OX1R_HUMAN Orexin receptor type 1
6tq6[2] C NVH
2-(5-methylsulfonylpyridin-3-yl)-1,1-bis(oxidanyli..
A 7.7
/35.0
13
/16
OX1R_HUMAN Orexin receptor type 1
3odu[9] C ITD
(6,6-dimethyl-5,6-dihydroimidazo[2,1-b][1,3]thiazo..
A 42.9
/30.2
7
/12
CXCR4_HUMAN LYS_BPT4 CXCR4_HUMAN C-X-C chemokine receptor type 4, Lysozyme Chimera
7l1v[1] G XGD
4'-methoxy-N,N-dimethyl-3'-{[3-(2-{[2-(2H-1,2,3-tr..
E 14.3
/29.1
21
/22
Q548Y0_HUMAN Hypocretin receptor type 2
8dzp[2] F U99
methyl (2S,4aR,6aR,7R,9S,10aS,10bR)-2-(furan-3-yl)..
A 60.0
/28.9
10
/18
OPRK_HUMAN Kappa-type opioid receptor
8hnn[1] C 43I
3-azanyl-6-chloranyl-5-[(3S)-4-[1-[(4-chlorophenyl..
B 22.2
/28.9
9
/9
C562_ECOLX CXCR3_HUMAN OPRK_HUMAN CXCR3_HUMAN Soluble cytochrome b562,C-X-C chemokine receptor t..
5wqc[3] B 7MA
N-ethyl-2-[(6-methoxypyridin-3-yl)-(2-methylphenyl..
A 11.8
/27.1
17
/17
OX2R_HUMAN Q9V2J8_PYRAB OX2R_HUMAN Orexin receptor type 2,GlgA glycogen synthase,Orex..
6tod[2] C 7MA
N-ethyl-2-[(6-methoxypyridin-3-yl)-(2-methylphenyl..
A 11.1
/28.6
18
/18
OX1R_HUMAN Orexin receptor type 1
7yit[1] D IVB
nalfurafine[35 atoms]
A 50.0
/28.9
10
/19
OPRK_HUMAN Kappa-type opioid receptor
3d4s[16] C CLR
CHOLESTEROL[28 atoms]
A 28.6
/25.3
7
/7
ADRB2_HUMAN LYS_BPT4 ADRB2_HUMAN Beta-2 adrenergic receptor/T4-lysozyme chimera
4ib4[22] D CLR
CHOLESTEROL[28 atoms]
A 40.0
/27.9
5
/8
5HT2B_HUMAN C562_ECOLX 5HT2B_HUMAN Chimera protein of human 5-hydroxytryptamine recep..
4xnv[131] C CLR
CHOLESTEROL[28 atoms]
A 20.0
/24.5
5
/6
P2RY1_HUMAN RUBR_CLOPA P2RY1_HUMAN P2Y purinoceptor 1, Rubredoxin, P2Y purinoceptor 1..
5jqh[2] F CLR
CHOLESTEROL[28 atoms]
A 25.0
/25.1
4
/4
ENLYS_BPT4 ADRB2_HUMAN Endolysin,Beta-2 adrenergic receptor
6lw5[1] C CLR
CHOLESTEROL[28 atoms]
A 33.3
/30.4
3
/3
C562_ECOLX FPR2_HUMAN Soluble cytochrome b562,N-formyl peptide receptor ..
6omm[4] H CLR
CHOLESTEROL[28 atoms]
A 33.3
/29.8
6
/6
FPR2_HUMAN N-formyl peptide receptor 2
6omm[1] I CLR
CHOLESTEROL[28 atoms]
A 33.3
/29.8
3
/3
FPR2_HUMAN N-formyl peptide receptor 2
6omm[5] J CLR
CHOLESTEROL[28 atoms]
A 0.0
/29.8
2
/2
FPR2_HUMAN N-formyl peptide receptor 2
6prz[8] C CLR
CHOLESTEROL[28 atoms]
A 25.0
/25.3
8
/8
ADRB2_HUMAN D9IEF7_BPT4 ADRB2_HUMAN Fusion protein of Beta-2 adrenergic receptor and T..
6pt2[1] E CLR
CHOLESTEROL[28 atoms]
A 33.3
/31.5
6
/6
Delta opioid receptor
6tpk[1] C CLR
CHOLESTEROL[28 atoms]
A 83.3
/62.9
6
/6
OXYR_HUMAN Oxytocin receptor
6v9s[1] C CLR
CHOLESTEROL[28 atoms]
A 50.0
/28.3
2
/5
OX1R_HUMAN Q9V2J8_PYRAB OX1R_HUMAN Orexin receptor type 1,GlgA glycogen synthase chim..
6wgt[1] E CLR
CHOLESTEROL[28 atoms]
A 11.1
/26.1
9
/9
5HT2A_HUMAN C562_ECOLX 5HT2A_HUMAN 5-hydroxytryptamine receptor 2A,Soluble cytochrome..
7bts[1] L CLR
CHOLESTEROL[28 atoms]
A 0.0
/26.6
4
/4
D9IEF7_BPT4 Lysozyme-Beta-1 adrenergic receptor chimera
7bu7[1] K CLR
CHOLESTEROL[28 atoms]
A 0.0
/25.5
1
/4
D9IEF7_BPT4 Endolysin,Endolysin,Beta-1 adrenergic receptor chi..
7dw9[1] I CLR
CHOLESTEROL[28 atoms]
A 71.4
/52.3
7
/7
V2R_HUMAN Vasopressin V2 receptor
7dw9[1] J CLR
CHOLESTEROL[28 atoms]
A 50.0
/52.3
4
/4
V2R_HUMAN Vasopressin V2 receptor
7f9y[1] I CLR
CHOLESTEROL[28 atoms]
F 77.8
/35.3
9
/9
Soluble cytochrome b562
7p00[2] G CLR
CHOLESTEROL[28 atoms]
E 37.5
/23.6
8
/9
NK1R_HUMAN Substance-P receptor
7t2g[1] F CLR
CHOLESTEROL[28 atoms]
D 33.3
/28.5
9
/9
C562_ECOLX OPRM_MOUSE Soluble cytochrome b562,Mu-type opioid receptor
7t2g[1] G CLR
CHOLESTEROL[28 atoms]
D 20.0
/28.5
10
/10
C562_ECOLX OPRM_MOUSE Soluble cytochrome b562,Mu-type opioid receptor
7vgz[1] G CLR
CHOLESTEROL[28 atoms]
A 33.3
/33.0
3
/9
MTR1A_HUMAN Melatonin receptor type 1A
7wc8[2] L CLR
CHOLESTEROL[21 atoms]
A 66.7
/28.0
3
/3
5HT2A_HUMAN 5HT2A_HUMAN 5-hydroxytryptamine receptor 2A,5-hydroxytryptamin..
7wq3[1] G CLR
CHOLESTEROL[28 atoms]
A 0.0
/28.2
3
/4
GALR1_HUMAN Galanin receptor type 1
7wq3[2] K CLR
CHOLESTEROL[28 atoms]
A 12.5
/28.2
8
/8
GALR1_HUMAN Galanin receptor type 1
7wq4[1] H CLR
CHOLESTEROL[28 atoms]
A 0.0
/33.2
4
/4
GALR2_HUMAN Galanin receptor type 2
7y27[1] G CLR
CHOLESTEROL[28 atoms]
D 100.0
/27.5
1
/1
SSR2_HUMAN Somatostatin receptor type 2
7yae[1] H CLR
CHOLESTEROL[28 atoms]
E 0.0
/27.2
3
/3
SSR2_HUMAN Somatostatin receptor type 2
8f7w[1] G CLR
CHOLESTEROL[28 atoms]
A 14.3
/28.4
7
/7
OPRK_HUMAN Kappa-type opioid receptor
8f7w[1] I CLR
CHOLESTEROL[28 atoms]
A 0.0
/28.4
1
/3
OPRK_HUMAN Kappa-type opioid receptor
8hk2[1] I CLR
CHOLESTEROL[28 atoms]
A 33.3
/31.9
3
/4
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8hk2[1] J CLR
CHOLESTEROL[28 atoms]
A 66.7
/31.9
3
/5
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
8hk2[1] K CLR
CHOLESTEROL[28 atoms]
A 25.0
/31.9
4
/7
C3AR_HUMAN C3a anaphylatoxin chemotactic receptor
5cxv[1] C 0HK
(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acety..
A 20.0
/28.9
10
/16
ACM1_HUMAN ENLYS_BPT4 ACM1_HUMAN Muscarinic acetylcholine receptor M1,Endolysin,Mus..
2vt4[37] G SOG
octyl 1-thio-beta-D-glucopyranoside[20 atoms]
A 33.3
/31.7
9
/9
ADRB1_MELGA BETA1 ADRENERGIC RECEPTOR
2vt4[3] H SOG
octyl 1-thio-beta-D-glucopyranoside[20 atoms]
A 0.0
/31.7
7
/7
ADRB1_MELGA BETA1 ADRENERGIC RECEPTOR
2vt4[13] I SOG
octyl 1-thio-beta-D-glucopyranoside[20 atoms]
A 25.0
/31.7
12
/12
ADRB1_MELGA BETA1 ADRENERGIC RECEPTOR
2vt4[28] M SOG
octyl 1-thio-beta-D-glucopyranoside[20 atoms]
A 0.0
/31.7
2
/2
ADRB1_MELGA BETA1 ADRENERGIC RECEPTOR
2ycx[2] E SOG
octyl 1-thio-beta-D-glucopyranoside[20 atoms]
B 0.0
/31.0
6
/6
ADRB1_MELGA BETA-1 ADRENERGIC RECEPTOR
6to7[21] F SOG
octyl 1-thio-beta-D-glucopyranoside[20 atoms]
A 25.0
/29.0
4
/4
OX1R_HUMAN Orexin receptor type 1
6to7[37] G SOG
octyl 1-thio-beta-D-glucopyranoside[20 atoms]
A 0.0
/29.0
5
/5
OX1R_HUMAN Orexin receptor type 1
6to7[4] N SOG
octyl 1-thio-beta-D-glucopyranoside[16 atoms]
A 50.0
/29.0
4
/6
OX1R_HUMAN Orexin receptor type 1
6to7[2] P SOG
octyl 1-thio-beta-D-glucopyranoside[9 atoms]
A 0.0
/29.0
1
/2
OX1R_HUMAN Orexin receptor type 1
6to7[2] Q SOG
octyl 1-thio-beta-D-glucopyranoside[8 atoms]
A 25.0
/29.0
4
/5
OX1R_HUMAN Orexin receptor type 1