Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4011309 918 151 P40189(IL6RB_HUMAN) RecName: Full=Interleukin-6 receptor subunit beta ; Short=IL-6 receptor subunit beta; Short=IL-6R subunit beta; Short=IL-6R-beta; Short=IL-6RB;AltName: Full=CDw130;AltName: Full=Interleukin-6 signal transducer;AltName: Full=Membrane glycoprotein 130; Short=gp130 ;AltName: Full=Oncostatin-M receptor subunit alpha;AltName: CD_antigen=CD130;Flags: Precursor;
QUERYSEQ
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGR
ETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESV
KKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESS
QNTSSTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P40189(IL6RB_HUMAN)]

918
region name description
1-22 SIGNAL
23-918 CHAIN /note="Interleukin-6 receptor subunit beta" /id="PRO_0000010899"
23-619 TOPO_DOM /note="Extracellular"
620-641 TRANSMEM /note="Helical"
642-918 TOPO_DOM /note="Cytoplasmic"
26-120 DOMAIN /note="Ig-like C2-type"
125-216 DOMAIN /note="Fibronectin type-III 1"
224-324 DOMAIN /note="Fibronectin type-III 2"
329-424 DOMAIN /note="Fibronectin type-III 3"
426-517 DOMAIN /note="Fibronectin type-III 4"
518-613 DOMAIN /note="Fibronectin type-III 5"
660-681 REGION /note="Disordered"
722-758 REGION /note="Disordered"
724-758 COMPBIAS /note="Polar residues"
1-918 DISORDER predicted by DISOPRED

MONOMER
918
pdb_id a1 identity[%]2 description
8d82 F 100.0 IL6RB_HUMAN Interleukin-6 receptor subunit beta
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
918 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1i1r[2] B Q98823_HHV8 VIRAL IL-6[167 aa] A 100.0
/100.0
11
/11
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN
1i1r[2] B Q98823_HHV8 VIRAL IL-6[167 aa] A 100.0
/100.0
18
/18
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN
1p9m[4] B IL6_HUMAN Interleukin-6[163 aa] A 100.0
/100.0
12
/12
IL6RB_HUMAN Interleukin-6 receptor beta chain
1p9m[4] B IL6_HUMAN Interleukin-6[163 aa] A 100.0
/100.0
16
/16
IL6RB_HUMAN Interleukin-6 receptor beta chain
1p9m[2] B IL6_HUMAN Interleukin-6[163 aa] C 18.2
/27.1
11
/15
IL6RA_HUMAN Interleukin-6 receptor alpha chain
5fuc[1] B IL6_HUMAN INTERLEUKIN-6[160 aa] C 25.0
/27.1
12
/18
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
8d82[2] B IL6_HUMAN Interleukin-6[169 aa] A 11.1
/28.2
9
/12
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
1p9m[2] C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] A 100.0
/100.0
11
/11
IL6RB_HUMAN Interleukin-6 receptor beta chain
1p9m[2] C IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] A 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor beta chain
7u7n[2] C IL27B_HUMAN Interleukin-27 subunit beta[200 aa] B 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
7u7n[2] D IL27A_HUMAN Interleukin-27 subunit alpha[191 aa] B 100.0
/100.0
12
/12
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d74[2] C CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. A 100.0
/100.0
11
/11
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d7h[3] B CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] A 0.0
/28.4
15
/17
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h[3] B CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] C 30.8
/29.8
13
/13
CRLF1_HUMAN Cytokine receptor-like factor 1
8d7h[2] E CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] C 18.2
/29.8
11
/11
CRLF1_HUMAN Cytokine receptor-like factor 1
8d7r[1] A CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] C 18.2
/29.9
11
/12
LIFR_HUMAN Leukemia inhibitory factor receptor
8d82[2] A IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. C 100.0
/100.0
11
/11
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d82[2] D IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. C 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dps[2] C I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] A 100.0
/100.0
11
/11
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dps[2] F I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] A 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dpt[8] C I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] A 100.0
/100.0
12
/12
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dpt[8] F I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] A 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
7z0l[1] B IL27B_MOUSE IL27A_MOUSE Interleukin-27 subunit beta,Interleukin-27 subunit.. A 78.6
/71.6
14
/14
IL6RB_MOUSE Interleukin-6 receptor subunit beta
8odz[3] A IL12A_MOUSE Interleukin-12 subunit alpha[156 aa] D 28.6
/30.0
7
/14
I12R2_MOUSE CALM1_HUMAN Interleukin-12 receptor subunit beta-2,Calmodulin-..
5x83[2] C DCC_HUMAN Netrin receptor DCC[95 aa] B 33.3
/39.0
3
/8
DCC_HUMAN Netrin receptor DCC
4urt[1] A NET1_HUMAN NETRIN-1[420 aa] B 37.5
/35.9
8
/13
DCC_HUMAN NETRIN RECEPTOR DCC
4urt[1] A NET1_HUMAN NETRIN-1[420 aa] B 40.0
/35.9
10
/15
DCC_HUMAN NETRIN RECEPTOR DCC
3ew3[2] A PRL_HUMAN Prolactin[185 aa] B 5.9
/33.0
17
/21
PRLR_RAT Prolactin receptor
1f6f[2] A CSH_SHEEP PLACENTAL LACTOGEN[183 aa] B 15.8
/33.1
19
/23
PRLR_RAT PROLACTIN RECEPTOR
5e4e[1] A IL13_HUMAN Interleukin-13[111 aa] C 28.6
/33.7
7
/22
I13R1_HUMAN Interleukin-13 receptor subunit alpha-1
5e4e[1] B IL4RA_HUMAN Interleukin-4 receptor subunit alpha[183 aa] C 14.3
/33.7
7
/11
I13R1_HUMAN Interleukin-13 receptor subunit alpha-1
3mzg[9] A PRL_HUMAN Prolactin[186 aa] B 11.8
/31.3
17
/22
PRLR_HUMAN Prolactin receptor
3bpn[1] A IL4_HUMAN Interleukin-4[126 aa] C 16.7
/32.4
6
/19
I13R1_HUMAN Interleukin-13 receptor alpha-1 chain
3bpn[1] B IL4RA_HUMAN Interleukin-4 receptor alpha chain[199 aa] C 20.0
/32.4
10
/10
I13R1_HUMAN Interleukin-13 receptor alpha-1 chain
1cd9[6] A CSF3_HUMAN PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)[17.. B 7.7
/33.7
13
/15
CSF3R_MOUSE PROTEIN (G-CSF RECEPTOR)
1cd9[6] C CSF3_HUMAN PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)[16.. B 0.0
/33.7
5
/5
CSF3R_MOUSE PROTEIN (G-CSF RECEPTOR)
2d9q[2] A CSF3_HUMAN CSF3[168 aa] B 10.0
/31.6
10
/11
CSF3R_HUMAN Granulocyte colony-stimulating factor receptor
2d9q[2] A CSF3_HUMAN CSF3[168 aa] B 22.2
/31.6
9
/9
CSF3R_HUMAN Granulocyte colony-stimulating factor receptor
3d48[1] A PRL_HUMAN Prolactin[165 aa] B 11.8
/31.6
17
/22
PRLR_HUMAN Prolactin receptor
1bp3[1] A SOMA_HUMAN PROTEIN (GROWTH HORMONE)[186 aa] B 10.5
/31.2
19
/23
PRLR_HUMAN PROTEIN (PROLACTIN RECEPTOR)
4i18[2] C antibody light chain[215 aa] E 50.0
/30.7
4
/5
PRLR_HUMAN Prolactin receptor
4i18[2] D antibody heavy chain[220 aa] E 15.0
/30.7
20
/21
PRLR_HUMAN Prolactin receptor
3di2[3] A IL7_HUMAN Interleukin-7[115 aa] B 50.0
/30.4
2
/12
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
5j11[1] A TSLP_HUMAN Thymic stromal lymphopoietin[114 aa] B 33.3
/30.4
3
/10
D6RGV2_HUMAN Interleukin-7 receptor subunit alpha
5j11[1] C CRLF2_HUMAN Cytokine receptor-like factor 2[190 aa] B 0.0
/30.4
9
/9
D6RGV2_HUMAN Interleukin-7 receptor subunit alpha
6p67[2] H Anti-IL-7R 2B8 Fab heavy chain[223 aa] G 0.0
/30.4
2
/2
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
6p67[2] C Anti-IL-7R 2B8 Fab heavy chain[223 aa] J 33.3
/30.4
3
/8
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
6p67[2] L anti-IL-7R 2B8 Fab light chain[213 aa] G 37.5
/30.4
8
/9
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
6p67[2] D anti-IL-7R 2B8 Fab light chain[213 aa] J 37.5
/30.4
8
/8
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
7opb[3] D IL7R binder[55 aa] A 25.0
/30.4
4
/11
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
1pvh[2] B LIF_HUMAN Leukemia inhibitory factor[169 aa] A 100.0
/100.0
13
/13
IL6RB_HUMAN Interleukin-6 receptor beta chain
2q7n[3] B LIF_HUMAN Leukemia inhibitory factor[180 aa] A 33.3
/28.4
6
/20
LIFR_MOUSE Leukemia inhibitory factor receptor
8d6a[1] A LIF_HUMAN Leukemia inhibitory factor[169 aa] B 100.0
/100.0
10
/10
IL6RB_HUMAN Interleukin-6 receptor subunit beta
7z3r[3] A LEP_MOUSE Leptin[141 aa] B 11.1
/27.8
18
/18
LEPR_MOUSE Leptin receptor
7z3r[3] A LEP_MOUSE Leptin[141 aa] B 7.7
/27.8
13
/17
LEPR_MOUSE Leptin receptor
8avb[1] A LEP_MOUSE Leptin[140 aa] B 12.5
/25.9
16
/17
LEPR_MOUSE Leptin receptor
8avb[8] A LEP_MOUSE Leptin[140 aa] C 11.1
/25.9
9
/13
LEPR_MOUSE Leptin receptor
8avc[7] A LEP_MOUSE Leptin[140 aa] B 14.3
/25.9
14
/14
LEPR_MOUSE Leptin receptor
8dh8[1] C LEP_MOUSE Leptin[141 aa] B 0.0
/26.4
3
/3
LEPR_MOUSE Leptin receptor
8dh9[1] C LEP_MOUSE Leptin[141 aa] A 20.0
/25.7
10
/12
LEPR_MOUSE Leptin receptor
8dh9[3] D LEP_MOUSE Leptin[146 aa] A 11.1
/25.7
9
/9
LEPR_MOUSE Leptin receptor
8d74[1] B CNTF_HUMAN Ciliary neurotrophic factor[174 aa] A 100.0
/100.0
12
/12
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d74[1] B CNTF_HUMAN Ciliary neurotrophic factor[174 aa] C 0.0
/28.0
13
/14
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d74[1] B CNTF_HUMAN Ciliary neurotrophic factor[174 aa] D 8.3
/29.9
12
/17
LIFR_HUMAN Leukemia inhibitory factor receptor
8odz[1] C I12R1_MOUSE DAPK1_HUMAN Interleukin-12 receptor subunit beta-1,Death-assoc.. D 0.0
/30.0
1
/5
I12R2_MOUSE CALM1_HUMAN Interleukin-12 receptor subunit beta-2,Calmodulin-..
8oe0[1] C I12R1_MOUSE DAPK1_HUMAN Interleukin-12 receptor subunit beta-1,Death-assoc.. D 16.7
/29.8
6
/9
I12R2_MOUSE CALM1_HUMAN Interleukin-12 receptor subunit beta-2,Calmodulin-..
3v6o[2] C Monoclonal antibody 9F8 fab fragment Heavy chain[2.. A 0.0
/29.1
2
/10
LEPR_HUMAN Leptin receptor
7z3q[3] C LEP_HUMAN Leptin[100 aa] B 7.1
/28.2
14
/15
LEPR_HUMAN Leptin receptor
8d7e[1] B H4H25311P2 antibody Fab fragment light chain[215 a.. A 0.0
/28.4
9
/9
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7e[1] C H4H25311P2 antibody Fab fragment heavy chain[217 a.. A 18.2
/28.4
11
/11
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d82[2] C IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 18.2
/28.2
11
/11
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82[2] F IL6RB_HUMAN Interleukin-6 receptor subunit beta[589 aa] A 0.0
/28.2
5
/6
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
5fuc[1] A IL6_HUMAN INTERLEUKIN-6[152 aa] D 30.0
/28.1
10
/12
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5fuc[1] F VHH6[124 aa] D 30.0
/28.1
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
8d74[2] A IL6RB_HUMAN Interleukin-6 receptor subunit beta[392 aa] C 27.3
/28.0
11
/11
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
7dc8[2] A Switch Ab Fab light chain[212 aa] C 40.0
/27.6
5
/5
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
7dc8[2] B Switch Ab Fab heavy chain[209 aa] C 14.3
/27.6
7
/9
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
5fuc[1] E VHH6[110 aa] C 30.0
/27.1
10
/10
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5mzv[1] A IL12B_HUMAN Interleukin-12 subunit beta[303 aa] C 0.0
/27.0
2
/3
IL23R_HUMAN Interleukin-23 receptor
6wdq[2] A IL12B_HUMAN Interleukin-12 subunit beta[303 aa] C 0.0
/27.0
2
/3
IL23R_HUMAN Interleukin-23 receptor
5mzv[1] B IL23A_HUMAN Interleukin-23 subunit alpha[137 aa] C 11.1
/27.0
9
/18
IL23R_HUMAN Interleukin-23 receptor
6wdq[2] B IL23A_HUMAN Interleukin-23 subunit alpha[147 aa] C 9.1
/27.0
11
/19
IL23R_HUMAN Interleukin-23 receptor
8av2[2] C anti-mLEPR VHH 4-80[129 aa] A 23.8
/25.4
21
/21
LEPR_MOUSE Leptin receptor
8dpt[2] A IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] C 26.7
/25.1
15
/15
I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpt[2] D IL6RB_HUMAN Interleukin-6 receptor subunit beta[398 aa] C 0.0
/25.1
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 25.0
/27.1
12
/12
IL6RA_HUMAN Interleukin-6 receptor alpha chain
1p9m[2] A IL6RB_HUMAN Interleukin-6 receptor beta chain[298 aa] C 0.0
/27.1
2
/8
IL6RA_HUMAN Interleukin-6 receptor alpha chain
8dpu[6] A IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] C 25.0
/24.7
12
/12
I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu[6] D IL6RB_HUMAN Interleukin-6 receptor subunit beta[298 aa] C 20.0
/24.7
5
/5
I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dps[10] B IL11_HUMAN Interleukin-11[165 aa] A 100.0
/100.0
10
/10
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dps[10] E IL11_HUMAN Interleukin-11[165 aa] A 100.0
/100.0
13
/13
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dpt[8] B IL11_HUMAN Interleukin-11[165 aa] C 5.6
/25.1
18
/18
I11RA_HUMAN Interleukin-11 receptor subunit alpha
8ave[8] A LEP_HUMAN Leptin[146 aa] B 14.3
/24.6
14
/14
LEPR_HUMAN Leptin receptor
8ave[6] C LEP_HUMAN Leptin[146 aa] B 0.0
/24.6
12
/14
LEPR_HUMAN Leptin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
918 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3up1[1] I FUC
alpha-L-fucopyranose[10 atoms]
B 0.0
/30.4
1
/1
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
3up1[1] J NGA
2-acetamido-2-deoxy-beta-D-galactopyranose[14 atom..
B 25.0
/30.4
8
/9
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
1n26[2] H CYS
CYSTEINE[7 atoms]
A 33.3
/28.2
3
/5
IL6A_HUMAN IL-6 Receptor alpha chain
3v6o[2] G CYS
CYSTEINE[7 atoms]
A 0.0
/29.1
1
/1
LEPR_HUMAN Leptin receptor
7dc8[2] H ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
C 0.0
/27.6
1
/1
IL6RA_HUMAN Interleukin-6 receptor subunit alpha
1cd9[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 50.0
/33.7
2
/2
CSF3R_MOUSE PROTEIN (G-CSF RECEPTOR)
1n26[6] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/28.2
5
/5
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 66.7
/28.2
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
2q7n[6] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/28.4
1
/2
LIFR_MOUSE Leukemia inhibitory factor receptor
5e4e[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/33.7
2
/2
I13R1_HUMAN Interleukin-13 receptor subunit alpha-1
5fuc[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 66.7
/27.1
3
/3
D6R9R8_HUMAN IL6RA_HUMAN INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-..
5mzv[1] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 33.3
/27.0
3
/3
IL23R_HUMAN Interleukin-23 receptor
6o4p[7] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/24.6
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6p67[18] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
K 0.0
/30.4
1
/1
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
6wdq[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 50.0
/27.0
2
/3
IL23R_HUMAN Interleukin-23 receptor
6wdq[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 33.3
/27.0
3
/3
IL23R_HUMAN Interleukin-23 receptor
6wdq[2] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/27.0
3
/3
IL23R_HUMAN Interleukin-23 receptor
6wdq[1] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/27.0
3
/6
IL23R_HUMAN Interleukin-23 receptor
7u7n[5] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
7z0l[1] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/71.6
2
/2
IL6RB_MOUSE Interleukin-6 receptor subunit beta
8av2[2] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 25.0
/25.4
4
/4
LEPR_MOUSE Leptin receptor
8av2[2] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/25.4
3
/3
LEPR_MOUSE Leptin receptor
8d6a[4] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
3
/3
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d6a[5] M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d74[2] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/28.0
1
/1
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h[2] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/29.8
1
/1
CRLF1_HUMAN Cytokine receptor-like factor 1
8d7h[2] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/29.8
1
/1
CRLF1_HUMAN Cytokine receptor-like factor 1
8d7r[1] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/29.9
3
/3
LIFR_HUMAN Leukemia inhibitory factor receptor
8d82[2] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/28.2
1
/3
IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha
8d82[4] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d82[2] Y NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
3
/3
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dps[10] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
918 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1pvh[1] E IOD
IODIDE ION[1 atoms]
A 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor beta chain
3mzg[7] C NA
SODIUM ION[1 atoms]
B 0.0
/31.3
1
/2
PRLR_HUMAN Prolactin receptor
3mzg[7] E NA
SODIUM ION[1 atoms]
B 40.0
/31.3
5
/5
PRLR_HUMAN Prolactin receptor
3mzg[7] F NA
SODIUM ION[1 atoms]
B 0.0
/31.3
5
/5
PRLR_HUMAN Prolactin receptor
3nce[1] C NA
SODIUM ION[1 atoms]
B 33.3
/32.4
3
/3
PRLR_HUMAN Prolactin receptor
7y8s[1] D NA
SODIUM ION[1 atoms]
B 50.0
/31.7
4
/4
A0A161FW14_MESMA Dscam
1bp3[1] C ZN
ZINC ION[1 atoms]
B 0.0
/31.2
2
/2
PRLR_HUMAN PROTEIN (PROLACTIN RECEPTOR)
8avc[4] G NI
NICKEL (II) ION[1 atoms]
B 0.0
/25.9
1
/2
LEPR_MOUSE Leptin receptor
3l5i[1] O CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] Q CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[3] T CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5j[1] F CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
5
/5
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5j[1] G CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3mzg[7] D CL
CHLORIDE ION[1 atoms]
B 100.0
/31.3
2
/2
PRLR_HUMAN Prolactin receptor
5mzv[1] L CL
CHLORIDE ION[1 atoms]
C 0.0
/27.0
2
/2
IL23R_HUMAN Interleukin-23 receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
918 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3l5h[1] C beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. A 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5h[1] F beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. A 100.0
/100.0
5
/5
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5h[1] G alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
7u7n[1] F alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/100.0
3
/3
IL6RB_HUMAN Interleukin-6 receptor subunit beta
2q7n[2] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/28.4
1
/1
LIFR_MOUSE Leukemia inhibitory factor receptor
3e0g[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 0.0
/30.2
2
/2
LIFR_HUMAN Leukemia inhibitory factor receptor
2q7n[1] K alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 25.0
/28.4
4
/4
LIFR_MOUSE Leukemia inhibitory factor receptor
3e0g[1] B alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/30.2
2
/4
LIFR_HUMAN Leukemia inhibitory factor receptor
3l5h[1] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
3
/3
IL6RB_HUMAN Interleukin-6 receptor subunit beta
5mzv[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 75.0
/27.0
4
/5
IL23R_HUMAN Interleukin-23 receptor
6p67[2] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. G 0.0
/30.4
2
/2
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
7u7n[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
7u7n[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8dpt[2] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 25.0
/25.1
4
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
8dpu[6] T beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 20.0
/24.7
5
/6
I11RA_HUMAN Interleukin-11 receptor subunit alpha
8oe0[1] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 0.0
/29.8
1
/1
I12R2_MOUSE CALM1_HUMAN Interleukin-12 receptor subunit beta-2,Calmodulin-..
2q7n[1] J alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 0.0
/28.4
3
/4
LIFR_MOUSE Leukemia inhibitory factor receptor
2q7n[1] R alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. C 33.3
/28.4
3
/3
LIFR_MOUSE Leukemia inhibitory factor receptor
1n26[2] B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. A 0.0
/28.2
6
/9
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/28.2
1
/5
IL6A_HUMAN IL-6 Receptor alpha chain
2d9q[6] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/31.6
4
/4
CSF3R_HUMAN Granulocyte colony-stimulating factor receptor
2q7n[2] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/28.4
1
/3
LIFR_MOUSE Leukemia inhibitory factor receptor
2q7n[1] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/28.4
1
/2
LIFR_MOUSE Leukemia inhibitory factor receptor
2q7n[3] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/28.4
3
/3
LIFR_MOUSE Leukemia inhibitory factor receptor
3di3[6] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/30.4
3
/3
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
3e0g[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 40.0
/30.2
5
/5
LIFR_HUMAN Leukemia inhibitory factor receptor
3l5h[11] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5h[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
5mzv[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/27.0
2
/3
IL23R_HUMAN Interleukin-23 receptor
6o4p[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/24.9
3
/4
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6wdq[2] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/27.0
2
/2
IL23R_HUMAN Interleukin-23 receptor
7u7n[4] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
7z0l[3] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/71.6
2
/2
IL6RB_MOUSE Interleukin-6 receptor subunit beta
7z0l[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/71.6
2
/2
IL6RB_MOUSE Interleukin-6 receptor subunit beta
7z0l[4] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 60.0
/71.6
5
/5
IL6RB_MOUSE Interleukin-6 receptor subunit beta
8d6a[3] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 33.3
/30.2
3
/4
LIFR_HUMAN Leukemia inhibitory factor receptor
8d6a[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 0.0
/30.2
1
/1
LIFR_HUMAN Leukemia inhibitory factor receptor
8d74[5] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 20.0
/28.0
5
/5
CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha..
8d7h[2] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 33.3
/29.8
3
/3
CRLF1_HUMAN Cytokine receptor-like factor 1
8d7h[2] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 50.0
/29.8
2
/2
CRLF1_HUMAN Cytokine receptor-like factor 1
8d82[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d82[2] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
6
/6
IL6RB_HUMAN Interleukin-6 receptor subunit beta
8d82[2] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
6o4p[1] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 25.0
/24.6
4
/5
I11RA_HUMAN Interleukin-11 receptor subunit alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
918 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1bqu[1] B IL6RB_HUMAN PROTEIN (GP130)[215 aa] A 100.0
/99.5
9
/9
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] A IL6RB_HUMAN PROTEIN (GP130)[208 aa] B 100.0
/99.5
11
/11
IL6RB_HUMAN PROTEIN (GP130)
5x83[2] D DCC_HUMAN Netrin receptor DCC[195 aa] B 100.0
/39.0
2
/15
DCC_HUMAN Netrin receptor DCC
1f6f[4] B PRLR_RAT PROLACTIN RECEPTOR[195 aa] C 16.7
/34.0
12
/12
PRLR_RAT PROLACTIN RECEPTOR
1f6f[1] C PRLR_RAT PROLACTIN RECEPTOR[169 aa] B 27.3
/33.1
11
/11
PRLR_RAT PROLACTIN RECEPTOR
3ew3[1] C PRLR_RAT Prolactin receptor[181 aa] B 45.5
/33.0
11
/11
PRLR_RAT Prolactin receptor
7y8s[2] B A0A161FW14_MESMA Dscam[288 aa] A 22.2
/32.3
27
/43
A0A161FW14_MESMA Dscam
3up1[2] B IL7RA_HUMAN Interleukin-7 receptor subunit alpha[196 aa] A 33.3
/30.4
3
/14
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
8d7h[2] F CRLF1_HUMAN Cytokine receptor-like factor 1[303 aa] C 0.0
/29.8
6
/6
CRLF1_HUMAN Cytokine receptor-like factor 1
1n26[1] A IL6A_HUMAN IL-6 Receptor alpha chain[299 aa] A 7.1
/28.2
14
/15
IL6A_HUMAN IL-6 Receptor alpha chain
8avb[1] C LEPR_MOUSE Leptin receptor[593 aa] B 0.0
/25.9
8
/8
LEPR_MOUSE Leptin receptor
8avb[1] B LEPR_MOUSE Leptin receptor[593 aa] C 12.5
/25.9
8
/9
LEPR_MOUSE Leptin receptor
8avc[2] D LEPR_MOUSE Leptin receptor[593 aa] B 0.0
/25.9
1
/2
LEPR_MOUSE Leptin receptor
8avc[3] F LEPR_MOUSE Leptin receptor[593 aa] B 0.0
/25.9
1
/1
LEPR_MOUSE Leptin receptor
8ave[10] D LEPR_HUMAN Leptin receptor[596 aa] B 16.7
/24.6
6
/7
LEPR_HUMAN Leptin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
918 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1bqu[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/99.5
6
/6
IL6RB_HUMAN PROTEIN (GP130)
1bqu[2] G GOL
GLYCEROL[6 atoms]
A 100.0
/99.5
8
/8
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] L GOL
GLYCEROL[6 atoms]
B 100.0
/99.5
6
/6
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] M GOL
GLYCEROL[6 atoms]
B 100.0
/99.5
4
/4
IL6RB_HUMAN PROTEIN (GP130)
3up1[1] H GOL
GLYCEROL[6 atoms]
A 0.0
/30.4
3
/3
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
3up1[1] N GOL
GLYCEROL[6 atoms]
A 0.0
/30.4
1
/1
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
4i18[2] K GOL
GLYCEROL[6 atoms]
E 50.0
/30.7
6
/6
PRLR_HUMAN Prolactin receptor
4i18[1] M GOL
GLYCEROL[6 atoms]
F 0.0
/31.2
3
/3
PRLR_HUMAN Prolactin receptor
4urt[2] Y GOL
GLYCEROL[6 atoms]
B 0.0
/35.9
2
/4
DCC_HUMAN NETRIN RECEPTOR DCC
6tpv[1] C IMD
IMIDAZOLE[5 atoms]
B 80.0
/33.3
5
/5
PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F
3d48[1] D CO3
CARBONATE ION[4 atoms]
B 100.0
/31.6
2
/2
PRLR_HUMAN Prolactin receptor
3d48[1] E CO3
CARBONATE ION[4 atoms]
B 25.0
/31.6
4
/4
PRLR_HUMAN Prolactin receptor
3d48[1] F CO3
CARBONATE ION[4 atoms]
B 20.0
/31.6
5
/8
PRLR_HUMAN Prolactin receptor
3ncc[1] G CO3
CARBONATE ION[4 atoms]
B 0.0
/32.4
2
/2
PRLR_HUMAN Prolactin receptor
3v6o[2] V ACT
ACETATE ION[4 atoms]
A 0.0
/29.1
1
/2
LEPR_HUMAN Leptin receptor
4i18[1] L ACT
ACETATE ION[4 atoms]
E 0.0
/30.7
2
/2
PRLR_HUMAN Prolactin receptor
3l5i[1] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 87.5
/100.0
8
/8
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[3] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
8
/8
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[3] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[3] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] P EDO
1,2-ETHANEDIOL[4 atoms]
A 83.3
/100.0
6
/6
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] R EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] S EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5i[1] U EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3v6o[1] K EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/29.1
3
/3
LEPR_HUMAN Leptin receptor
3v6o[2] L EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/29.1
3
/3
LEPR_HUMAN Leptin receptor
3v6o[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/29.1
2
/4
LEPR_HUMAN Leptin receptor
3v6o[1] O EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/29.1
1
/6
LEPR_HUMAN Leptin receptor
3v6o[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/28.7
3
/3
LEPR_HUMAN Leptin receptor
3v6o[1] R EDO
1,2-ETHANEDIOL[4 atoms]
B 20.0
/28.7
5
/5
LEPR_HUMAN Leptin receptor
7opb[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/30.4
4
/4
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
7opb[1] G PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/30.4
1
/7
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
7opb[2] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 0.0
/30.4
1
/6
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
7z3p[1] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/29.9
1
/5
LEPR_MOUSE Leptin receptor
1bqu[3] C SO4
SULFATE ION[5 atoms]
A 100.0
/99.5
4
/4
IL6RB_HUMAN PROTEIN (GP130)
1bqu[12] E SO4
SULFATE ION[5 atoms]
A 100.0
/99.5
2
/2
IL6RB_HUMAN PROTEIN (GP130)
1bqu[1] I SO4
SULFATE ION[5 atoms]
B 100.0
/99.5
2
/2
IL6RB_HUMAN PROTEIN (GP130)
1bqu[4] J SO4
SULFATE ION[5 atoms]
B 100.0
/99.5
3
/3
IL6RB_HUMAN PROTEIN (GP130)
1n26[2] F SO4
SULFATE ION[5 atoms]
A 0.0
/28.2
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
1n26[2] G SO4
SULFATE ION[5 atoms]
A 66.7
/28.2
3
/3
IL6A_HUMAN IL-6 Receptor alpha chain
3l5h[1] I SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5h[1] J SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3l5h[1] K SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
IL6RB_HUMAN Interleukin-6 receptor subunit beta
3up1[1] F SO4
SULFATE ION[5 atoms]
A 0.0
/30.4
3
/4
IL7RA_HUMAN Interleukin-7 receptor subunit alpha
4urt[1] L SO4
SULFATE ION[5 atoms]
B 100.0
/35.9
1
/1
DCC_HUMAN NETRIN RECEPTOR DCC
4urt[1] O SO4
SULFATE ION[5 atoms]
B 50.0
/35.9
2
/2
DCC_HUMAN NETRIN RECEPTOR DCC
4urt[2] X SO4
SULFATE ION[5 atoms]
B 50.0
/35.9
2
/2
DCC_HUMAN NETRIN RECEPTOR DCC
5e4e[1] J SO4
SULFATE ION[5 atoms]
C 25.0
/33.7
4
/4
I13R1_HUMAN Interleukin-13 receptor subunit alpha-1
5e4e[1] K SO4
SULFATE ION[5 atoms]
C 40.0
/33.7
5
/5
I13R1_HUMAN Interleukin-13 receptor subunit alpha-1
5e4e[1] L SO4
SULFATE ION[5 atoms]
C 50.0
/33.7
2
/2
I13R1_HUMAN Interleukin-13 receptor subunit alpha-1
6o4p[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/24.6
1
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[2] J SO4
SULFATE ION[5 atoms]
A 66.7
/24.6
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[1] L SO4
SULFATE ION[5 atoms]
B 0.0
/24.9
2
/2
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[1] M SO4
SULFATE ION[5 atoms]
B 0.0
/24.9
3
/3
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6o4p[1] P SO4
SULFATE ION[5 atoms]
B 0.0
/24.9
1
/1
I11RA_HUMAN Interleukin-11 receptor subunit alpha
6tpw[2] B SO4
SULFATE ION[5 atoms]
A 0.0
/31.4
2
/4
PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F
8av2[2] G SO4
SULFATE ION[5 atoms]
A 66.7
/25.4
3
/3
LEPR_MOUSE Leptin receptor
8av2[2] H SO4
SULFATE ION[5 atoms]
A 0.0
/25.4
2
/2
LEPR_MOUSE Leptin receptor
8av2[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/25.4
3
/3
LEPR_MOUSE Leptin receptor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.