Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1693856 43 0 P0DTD8(NS7B_SARS2) RecName: Full=ORF7b protein; Short=ORF7b;AltName: Full=Accessory protein 7b;
QUERYSEQ
MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTD8(NS7B_SARS2)]

43
region name description
1-43 CHAIN /note="ORF7b protein" /id="PRO_0000449799"
9-29 TRANSMEM /note="Helical"

No homologue is found in PDB.

Please check [SiteTable] for homologues.