Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3206814 215 81 P09429(HMGB1_HUMAN) RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1;
QUERYSEQ
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK
LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P09429(HMGB1_HUMAN)]

215
region name description
1-215 CHAIN /note="High mobility group protein B1" /id="PRO_0000048526"
9-79 DNA_BIND /note="HMG box 1"
95-163 DNA_BIND /note="HMG box 2"
1-97 REGION /note="Sufficient for interaction with HAVCR2"
3-15 REGION /note="LPS binding (delipidated)"
76-95 REGION /note="Disordered"
80-96 REGION /note="LPS binding (Lipid A)"
89-108 REGION /note="Cytokine-stimulating activity"
150-183 REGION /note="Binding to AGER/RAGE"
161-215 REGION /note="Disordered"
76-94 COMPBIAS /note="Basic and acidic residues"
161-187 COMPBIAS /note="Basic and acidic residues"
188-215 COMPBIAS /note="Acidic residues"
1-10 BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304"
1-215 DISORDER predicted by DISOPRED

MONOMER
215
pdb_id a1 identity[%]2 description
2yrq A 100.0
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.