Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1223551 | 215 | 80 | P09429(HMGB1_HUMAN) | RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1; |
QUERYSEQ |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
215 | region | name | description |
1-215 | CHAIN | /note="High mobility group protein B1" /id="PRO_0000048526" | |
9-79 | DNA_BIND | /note="HMG box 1" | |
95-163 | DNA_BIND | /note="HMG box 2" | |
1-97 | REGION | /note="Sufficient for interaction with HAVCR2" | |
3-15 | REGION | /note="LPS binding (delipidated)" | |
76-95 | REGION | /note="Disordered" | |
80-96 | REGION | /note="LPS binding (Lipid A)" | |
89-108 | REGION | /note="Cytokine-stimulating activity" | |
150-183 | REGION | /note="Binding to AGER/RAGE" | |
161-215 | REGION | /note="Disordered" | |
76-94 | COMPBIAS | /note="Basic and acidic residues" | |
161-187 | COMPBIAS | /note="Basic and acidic residues" | |
188-215 | COMPBIAS | /note="Acidic residues" | |
1-10 | BINDING | /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" | |
1-215 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
215 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
2yrq | A | 100.0 | HMGB1_HUMAN High mobility group protein B1 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2ly4[1] | B | P53_HUMAN Cellular tumor antigen p53[47 aa] | A | 100.0 /100.0 |
17 /17 |
HMGB1_HUMAN High mobility group protein B1 | |
6cij[2] | A | RAG1_MOUSE V(D)J recombination-activating protein 1[614 aa] | G | 100.0 /100.0 |
3 /3 |
HMGB1_HUMAN High mobility group protein B1 | |
8i9m[1] | B | RAGE_HUMAN Advanced glycosylation end product-specific recept.. | A | 100.0 /100.0 |
14 /14 |
HMGB1_HUMAN High mobility group protein B1 | |
6erp[4] | G | RPOM_HUMAN DNA-directed RNA polymerase, mitochondrial[1011 aa.. | A | 10.0 /29.3 |
10 /11 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1ckt[1] | A | DNA (5'-D(*CP*CP*(5IU)P*CP*TP*CP*TP*GP*GP*AP*CP*CP.. | C | 100.0 /100.0 |
9 /9 |
HMG1_RAT HIGH MOBILITY GROUP 1 PROTEIN | |
1ckt[1] | B | DNA (5'-D(*GP*GP*AP*AP*GP*GP*TP*CP*CP*AP*GP*AP*GP*.. | C | 100.0 /100.0 |
10 /10 |
HMG1_RAT HIGH MOBILITY GROUP 1 PROTEIN | |
4qr9[2] | C | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
11 /11 |
HMGB1_RAT High mobility group protein B1 | |
4qr9[2] | D | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
10 /11 |
HMGB1_RAT High mobility group protein B1 | |
4qr9[1] | F | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
2 /4 |
HMGB1_RAT High mobility group protein B1 | |
5zdz[3] | I | DNA (39-MER) | E | 100.0 /100.0 |
10 /10 |
HMGB1_MOUSE HMGB1 A-B box | |
5zdz[3] | K | DNA chain M | E | 100.0 /100.0 |
11 /11 |
HMGB1_MOUSE HMGB1 A-B box | |
5ze2[1] | H | DNA (40-MER) | E | 100.0 /100.0 |
7 /7 |
HMGB1_MOUSE HMGB1 A-B box | |
5ze2[1] | J | DNA (40-MER) | E | 100.0 /100.0 |
10 /10 |
HMGB1_MOUSE HMGB1 A-B box | |
6cg0[1] | H | DNA (60-MER) | K | 100.0 /100.0 |
12 /12 |
HMGB1_HUMAN High mobility group protein B1 | |
6cg0[1] | J | DNA (41-MER) | K | 100.0 /100.0 |
11 /11 |
HMGB1_HUMAN High mobility group protein B1 | |
6cij[1] | K | DNA (41-MER) | G | 100.0 /100.0 |
12 /12 |
HMGB1_HUMAN High mobility group protein B1 | |
6cij[1] | F | DNA (60-MER) | G | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 | |
6cik[1] | H | Nicked 23RSS intermediate reverse strand | E | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 | |
6cik[1] | J | Nicked 23RSS intermediate forward strand | E | 100.0 /100.0 |
6 /6 |
HMGB1_HUMAN High mobility group protein B1 | |
6cil[1] | H | Intact 23RSS substrate reverse strand | E | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 | |
6cim[1] | I | Intact 23RSS substrate reverse strand | E | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 | |
6cim[1] | J | Intact 23RSS substrate forward strand | E | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | E | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[1] | E | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | H | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[2] | H | DNA (57-MER) | I | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | F | DNA (46-MER) | J | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[2] | F | DNA (46-MER) | J | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 | |
6oem[1] | G | DNA (46-MER) | J | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 | |
6oen[2] | G | DNA (46-MER) | J | 100.0 /100.0 |
3 /3 |
HMGB1_HUMAN High mobility group protein B1 | |
6oer[1] | G | DNA (57-MER) | I | 100.0 /100.0 |
5 /5 |
HMGB1_HORSE High mobility group protein B1 | |
2gzk[1] | A | 5'-D(*GP*GP*GP*AP*TP*CP*TP*AP*AP*AP*CP*AP*AP*TP*GP.. | C | 71.4 /67.1 |
28 /33 |
Q6J415_HUMAN Q548R9_RAT Sex-determining region on Y / HMGB1 | |
2gzk[1] | B | 5'-D(*GP*CP*AP*TP*TP*GP*TP*TP*TP*AP*GP*AP*TP*CP*CP.. | C | 75.0 /67.1 |
24 /26 |
Q6J415_HUMAN Q548R9_RAT Sex-determining region on Y / HMGB1 | |
1qrv[1] | A | DNA (5'-D(*GP*CP*GP*AP*TP*AP*TP*CP*GP*C)-3') | C | 46.7 /44.3 |
15 /16 |
HMGD_DROME HIGH MOBILITY GROUP PROTEIN D | |
1qrv[3] | B | DNA (5'-D(*GP*CP*GP*AP*TP*AP*TP*CP*GP*C)-3') | C | 50.0 /44.3 |
8 /8 |
HMGD_DROME HIGH MOBILITY GROUP PROTEIN D | |
1j5n[1] | A | 5'-D(*GP*GP*GP*GP*TP*GP*AP*TP*TP*GP*TP*TP*CP*AP*G).. | C | 33.3 /45.9 |
12 /18 |
NHP6A_YEAST Nonhistone chromosomal protein 6A | |
1j5n[1] | B | 5'-D(*CP*TP*GP*AP*AP*CP*AP*AP*TP*CP*AP*CP*CP*CP*C).. | C | 61.5 /45.9 |
13 /16 |
NHP6A_YEAST Nonhistone chromosomal protein 6A | |
8r1x[1] | B | DNA (5'-D(*CP*GP*AP*TP*AP*TP*TP*AP*AP*GP*AP*GP*CP*.. | A | 72.7 /45.7 |
11 /11 |
HMGD_DROME High mobility group protein D | |
8r1x[1] | C | DNA (5'-D(*GP*GP*CP*TP*CP*AP*AP*TP*AP*TP*CP*G)-3').. | A | 50.0 /45.7 |
6 /6 |
HMGD_DROME High mobility group protein D | |
3nm9[15] | G | DNA 5'-D(*G*GP*CP*GP*AP*TP*AP*TP*CP*GP*C)-3' | A | 50.0 /44.3 |
2 /2 |
HMGD_DROME High mobility group protein D | |
3nm9[1] | P | DNA 5'-D(*G*GP*CP*GP*AP*TP*AP*TP*CP*GP*C)-3' | B | 0.0 /44.3 |
1 /1 |
HMGD_DROME High mobility group protein D | |
3nm9[1] | N | DNA 5'-D(*G*GP*CP*GP*AP*TP*AP*TP*CP*GP*C)-3' | B | 100.0 /44.3 |
4 /4 |
HMGD_DROME High mobility group protein D | |
3nm9[2] | N | DNA 5'-D(*G*GP*CP*GP*AP*TP*AP*TP*CP*GP*C)-3' | D | 40.0 /44.3 |
5 /5 |
HMGD_DROME High mobility group protein D | |
5jh0[1] | B | DNA (5'-D(*AP*AP*TP*AP*AP*TP*AP*AP*AP*TP*TP*AP*TP*.. | A | 41.7 /30.3 |
12 /16 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jh0[2] | E | DNA (5'-D(*AP*AP*TP*AP*AP*TP*AP*AP*AP*TP*TP*AP*TP*.. | A | 44.4 /30.3 |
18 /18 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jh0[1] | C | DNA (5'-D(*TP*TP*AP*TP*AP*TP*TP*AP*TP*AP*TP*AP*AP*.. | A | 28.6 /30.3 |
7 /10 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jh0[2] | F | DNA (5'-D(*TP*TP*AP*TP*AP*TP*TP*AP*TP*AP*TP*AP*AP*.. | A | 50.0 /30.3 |
12 /12 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jgh[3] | B | DNA (5'-D(*TP*TP*TP*AP*TP*TP*AP*TP*TP*TP*TP*AP*TP*.. | A | 50.0 /30.3 |
12 /17 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jgh[4] | E | DNA (5'-D(*TP*TP*TP*AP*TP*TP*AP*TP*TP*TP*TP*AP*TP*.. | A | 42.9 /30.3 |
14 /14 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jgh[3] | C | DNA (5'-D(*TP*TP*AP*TP*AP*TP*AP*AP*TP*AP*TP*AP*AP*.. | A | 20.0 /30.3 |
5 /7 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jgh[4] | F | DNA (5'-D(*TP*TP*AP*TP*AP*TP*AP*AP*TP*AP*TP*AP*AP*.. | A | 45.5 /30.3 |
11 /11 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
4euw[1] | B | DNA (5'-D(*CP*TP*CP*TP*TP*TP*GP*AP*GP*AP*AP*G)-3').. | A | 36.4 /30.2 |
11 /12 |
SOX9_HUMAN Transcription factor SOX-9 | |
4euw[1] | C | DNA (5'-D(*CP*TP*TP*CP*TP*CP*AP*AP*AP*GP*AP*G)-3').. | A | 33.3 /30.2 |
9 /12 |
SOX9_HUMAN Transcription factor SOX-9 | |
4s2q[1] | A | DNA (5'-D(P*AP*GP*GP*CP*TP*TP*TP*GP*TP*TP*CP*TP*CP.. | C | 46.2 /30.2 |
13 /16 |
SOX9_MOUSE Transcription factor SOX-9 | |
4s2q[1] | B | DNA (5'-D(P*AP*GP*GP*AP*GP*AP*AP*CP*AP*AP*AP*GP*CP.. | C | 37.5 /30.2 |
8 /12 |
SOX9_MOUSE Transcription factor SOX-9 | |
3u2b[1] | A | DNA (5'-D(*GP*TP*CP*TP*CP*TP*AP*TP*TP*GP*TP*CP*CP*.. | C | 35.7 /30.0 |
14 /14 |
SOX4_MOUSE Transcription factor SOX-4 | |
3u2b[1] | B | DNA (5'-D(*CP*CP*AP*GP*GP*AP*CP*AP*AP*TP*AP*GP*AP*.. | C | 27.3 /30.0 |
11 /15 |
SOX4_MOUSE Transcription factor SOX-4 | |
7lbw[2] | C | DNA (5'-D(P*TP*AP*GP*CP*CP*TP*TP*TP*CP*TP*AP*TP*TP.. | A | 50.0 /28.6 |
16 /18 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[2] | E | DNA (5'-D(P*TP*AP*GP*CP*CP*TP*TP*TP*CP*TP*AP*TP*TP.. | A | 44.4 /28.6 |
9 /11 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[2] | D | DNA (5'-D(P*TP*AP*GP*CP*CP*TP*TP*TP*CP*TP*AP*TP*TP.. | A | 33.3 /28.6 |
12 /14 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[2] | F | DNA (5'-D(P*TP*AP*GP*CP*CP*TP*TP*TP*CP*TP*AP*TP*TP.. | A | 33.3 /28.6 |
12 /12 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbx[1] | C | DNA (5'-D(P*TP*TP*AP*AP*CP*AP*GP*TP*CP*AP*CP*CP*CP.. | A | 41.7 /29.7 |
24 /27 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbx[1] | D | DNA (5'-D(P*TP*TP*AP*GP*TP*TP*GP*GP*GP*GP*GP*GP*TP.. | A | 32.0 /29.7 |
25 /26 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6erp[2] | B | Non-Template DNA | A | 37.5 /29.3 |
24 /24 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6erp[2] | C | Template DNA | A | 42.9 /29.3 |
21 /24 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6erq[2] | B | Non-Template DNA | A | 33.3 /29.3 |
24 /24 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6erq[2] | C | Template DNA | A | 55.6 /29.3 |
18 /21 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
3tq6[1] | C | DNA (5'-D(*TP*AP*AP*CP*AP*GP*TP*CP*AP*CP*CP*CP*CP*.. | A | 28.0 /28.6 |
25 /28 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
3tq6[1] | D | DNA (5'-D(*GP*TP*TP*AP*GP*TP*TP*GP*GP*GP*GP*GP*GP*.. | A | 36.0 /28.6 |
25 /27 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
4nnu[2] | C | DNA1 | A | 40.0 /28.6 |
25 /30 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
4nnu[2] | E | DNA2 | A | 38.1 /28.6 |
21 /22 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
4nnu[2] | F | DNA2 | A | 33.3 /28.6 |
3 /3 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6hb4[4] | B | DNA (5'*CP*TP*GP*TP*GP*CP*AP*GP*AP*CP*AP*TP*TP*CP*.. | A | 36.7 /28.9 |
30 /33 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6hb4[4] | C | DNA (5'-D(*TP*AP*AP*CP*AP*AP*TP*TP*GP*AP*AP*TP*GP*.. | A | 40.0 /28.9 |
20 /21 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1qrv[1] | E |
NA
SODIUM ION[1 atoms] |
C | 0.0 /44.3 |
1 /1 |
HMGD_DROME HIGH MOBILITY GROUP PROTEIN D | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4qr9[2] | B | HMGB1_RAT High mobility group protein B1[75 aa] | A | 100.0 /100.0 |
5 /5 |
HMGB1_RAT High mobility group protein B1 | |
3nm9[1] | E | HMGD_DROME High mobility group protein D[73 aa] | B | 75.0 /44.3 |
4 /4 |
HMGD_DROME High mobility group protein D | |
3nm9[4] | F | HMGD_DROME High mobility group protein D[73 aa] | B | 66.7 /44.3 |
6 /6 |
HMGD_DROME High mobility group protein D | |
3nm9[1] | B | HMGD_DROME High mobility group protein D[73 aa] | E | 75.0 /44.3 |
8 /8 |
HMGD_DROME High mobility group protein D | |
4nnu[2] | B | TFAM_HUMAN Transcription factor A, mitochondrial[192 aa] | A | 66.7 /28.6 |
3 /13 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[1] | B | TFAM_HUMAN Transcription factor A, mitochondrial[190 aa] | A | 50.0 /28.6 |
4 /10 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
215 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1hsm[2] | B |
BME
BETA-MERCAPTOETHANOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
HMG1_CRIGR HIGH MOBILITY GROUP PROTEIN 1 | |
5jgh[1] | M |
ACT
ACETATE ION[4 atoms] |
G | 50.0 /30.3 |
4 /4 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
5jgh[1] | N |
ACT
ACETATE ION[4 atoms] |
G | 100.0 /30.3 |
1 /1 |
ABF2_YEAST ARS-binding factor 2, mitochondrial | |
7lbw[1] | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 0.0 /28.6 |
3 /4 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[1] | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /29.7 |
1 /3 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[1] | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 0.0 /29.7 |
2 /2 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[1] | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 33.3 /29.7 |
3 /3 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[1] | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /29.7 |
2 /2 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[1] | M |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 0.0 /29.7 |
2 /2 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
7lbw[1] | N |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 50.0 /29.7 |
2 /5 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6hb4[2] | M |
GOL
GLYCEROL[6 atoms] |
A | 50.0 /28.9 |
4 /4 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6hb4[1] | O |
1PE
PENTAETHYLENE GLYCOL[16 atoms] |
A | 100.0 /28.9 |
1 /3 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
6hb4[2] | Q |
1PE
PENTAETHYLENE GLYCOL[16 atoms] |
D | 0.0 /28.6 |
1 /5 |
TFAM_HUMAN Transcription factor A, mitochondrial | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |