Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4057923 925 211 O95786(RIGI_HUMAN) RecName: Full=Antiviral innate immune response receptor RIG-I ;AltName: Full=ATP-dependent RNA helicase DDX58 ; EC=3.6.4.13 ;AltName: Full=DEAD box protein 58;AltName: Full=RIG-I-like receptor 1; Short=RLR-1;AltName: Full=RNA sensor RIG-I ;AltName: Full=Retinoic acid-inducible gene 1 protein; Short=RIG-1;AltName: Full=Retinoic acid-inducible gene I protein; Short=RIG-I;
QUERYSEQ
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMA
GAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQI
PVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELE
QVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESV
SRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEK
EQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATG
VQTLYSKWKDFHFEKIPFDPAEMSK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O95786(RIGI_HUMAN)]

925
region name description
1-925 CHAIN /note="Antiviral innate immune response receptor RIG-I" /id="PRO_0000144093"
1-87 DOMAIN /note="CARD 1"
92-172 DOMAIN /note="CARD 2"
251-430 DOMAIN /note="Helicase ATP-binding"
610-776 DOMAIN /note="Helicase C-terminal"
794-925 DOMAIN /note="RLR CTR"
218-925 REGION /note="Interaction with ZC3HAV1"
735-925 REGION /note="Mediates interaction with RNF135"
264-271 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
810-810 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
813-813 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
864-864 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
869-869 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
1-925 DISORDER predicted by DISOPRED

MONOMER
925
pdb_id a1 identity[%]2 description
7to0 A 100.0 DDX58_HUMAN Antiviral innate immune response receptor RIG-I
4a2w A 55.7 D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
925 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7jl1[4] D RN135_HUMAN E3 ubiquitin-protein ligase RNF135[171 aa] A 100.0
/100.0
10
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl3[2] D RN135_HUMAN E3 ubiquitin-protein ligase RNF135[169 aa] A 100.0
/100.0
1
/1
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[6] B RN135_HUMAN E3 ubiquitin-protein ligase RNF135[178 aa] A 100.0
/100.0
13
/13
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[1] B RN135_HUMAN E3 ubiquitin-protein ligase RNF135[178 aa] C 100.0
/100.0
1
/1
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
4nqk[6] E UBC_HUMAN Ubiquitin[72 aa] A 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4nqk[9] J UBC_HUMAN Ubiquitin[73 aa] A 100.0
/100.0
9
/9
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4nqk[5] F UBC_HUMAN Ubiquitin[73 aa] B 100.0
/100.0
11
/11
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4p4h[1] Q RL40_HUMAN Ubiquitin-60S ribosomal protein L40[73 aa] H 100.0
/99.5
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4p4h[8] I MAVS_HUMAN Mitochondrial antiviral-signaling protein[97 aa] A 100.0
/99.5
11
/11
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4p4h[6] I MAVS_HUMAN Mitochondrial antiviral-signaling protein[97 aa] B 100.0
/99.5
6
/6
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4p4h[3] I MAVS_HUMAN Mitochondrial antiviral-signaling protein[97 aa] C 100.0
/99.5
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4p4h[2] I MAVS_HUMAN Mitochondrial antiviral-signaling protein[97 aa] D 100.0
/99.5
9
/9
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7jl0[4] D TRI65_HUMAN Tripartite motif-containing protein 65[180 aa] C 33.3
/40.2
9
/11
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
4i1s[1] B V_SV5 Non-structural protein V[52 aa] A 44.0
/37.6
25
/26
A7LCX1_PIG A7LCX1_PIG Melanoma differentiation associated protein-5
7v6c[1] B Q9VLW8_DROME R2D2[260 aa] A 100.0
/32.5
1
/43
A1ZAW0_DROME Dicer-2, isoform A
5m59[4] A G0SFL3_CHATD Putative pre-mRNA splicing factor[266 aa] B 28.6
/31.9
7
/57
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
7w0a[8] B M9MRT5_DROME Loquacious, isoform D[16 aa] A 33.3
/29.7
21
/27
A1ZAW0_DROME Dicer-2, isoform A
7w0d[1] C M9MRT5_DROME Loquacious, isoform D[13 aa] E 34.8
/29.7
23
/25
A1ZAW0_DROME Dicer-2, isoform A
8hf0[5] C Q9VLW8_DROME LD06392p[126 aa] A 19.0
/29.7
21
/31
A1ZAW0_DROME Dicer-2, isoform A
8hf0[3] C Q9VLW8_DROME LD06392p[126 aa] D 20.0
/29.7
5
/11
A1ZAW0_DROME Dicer-2, isoform A
8hf1[1] B M9MRT5_DROME Loquacious, isoform D[16 aa] A 31.6
/29.7
19
/23
A1ZAW0_DROME Dicer-2, isoform A
8dfv[2] C Q9VJY9_DROME Loquacious, isoform B[253 aa] A 0.0
/24.1
3
/55
DCR1_DROME Endoribonuclease Dcr-1
8dg7[1] D Q9VJY9_DROME Loquacious, isoform B[181 aa] A 0.0
/23.7
3
/46
DCR1_DROME Endoribonuclease Dcr-1
8dgi[2] B Q9VJY9_DROME Loquacious, isoform B[108 aa] A 0.0
/23.7
2
/23
DCR1_DROME Endoribonuclease Dcr-1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
925 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3ncu[2] C 5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3' A 100.0
/100.0
13
/13
DDX58_HUMAN RIG-I
3ncu[2] D 5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3' A 100.0
/100.0
4
/4
DDX58_HUMAN RIG-I
7bai[4] C RNA (5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C).. A 100.0
/100.0
11
/11
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7bai[4] D RNA (5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C).. A 100.0
/100.0
3
/3
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
5e3h[1] B RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*U)-3').. A 100.0
/100.0
18
/18
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5e3h[1] C RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*U)-3').. A 100.0
/100.0
27
/27
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[12] B RNA (5'-R(P*GP*AP*AP*UP*AP*UP*AP*AP*UP*AP*GP*UP*GP.. A 100.0
/100.0
40
/40
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[6] B RNA (5'-R(P*AP*AP*UP*AP*UP*AP*AP*UP*AP*GP*UP*GP*AP.. A 100.0
/100.0
37
/37
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
6kyv[6] A RNA (5'-R(*GP*GP*UP*AP*GP*AP*CP*GP*CP*UP*UP*CP*GP*.. B 100.0
/100.0
46
/46
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7bah[2] C RNA (5'-R(*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3').. A 100.0
/100.0
11
/11
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7bah[2] D RNA (5'-R(*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3').. A 100.0
/100.0
3
/3
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl0[1] A RNA (5'-R(P*GP*AP*CP*UP*GP*AP*CP*UP*GP*AP*CP*UP*GP.. C 60.0
/40.2
10
/11
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[1] B dsRNA strand 1 A 100.0
/100.0
17
/17
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl0[1] B RNA (5'-R(P*UP*CP*AP*GP*UP*CP*AP*GP*UP*CP*AP*GP*UP.. C 71.4
/40.2
21
/21
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[1] C dsRNA strand 2 A 100.0
/100.0
27
/27
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl3[3] G dsRNA strand1 A 100.0
/100.0
14
/14
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl3[3] H dsRNA strand 2 A 100.0
/100.0
24
/24
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7mk1[2] C DNA (41-MER) A 100.0
/100.0
17
/17
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tnx[1] B p3dsRNAa A 100.0
/100.0
24
/24
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tnx[1] C p3dsRNAb A 100.0
/100.0
21
/21
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tny[2] B p2dsRNA A 100.0
/100.0
26
/26
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tny[2] C p2dsRNA A 100.0
/100.0
29
/29
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to0[1] B OHdsRNA A 100.0
/100.0
27
/27
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to0[1] C OHdsRNA A 100.0
/100.0
28
/28
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to1[1] B p3SLR30 A 100.0
/100.0
41
/41
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to2[1] B p3SLR30 A 100.0
/100.0
57
/57
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8dvr[1] B p3SLR30 A 100.0
/100.0
33
/33
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8dvs[1] B OHSLR30 A 100.0
/100.0
48
/48
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8dvu[1] B OHSLR30 A 100.0
/100.0
55
/55
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] E p3dsRNA24a A 100.0
/100.0
22
/22
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] E p3dsRNA24a C 100.0
/100.0
21
/21
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] F p3dsRNA24b A 100.0
/100.0
24
/24
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] F p3dsRNA24b C 100.0
/100.0
16
/16
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[2] E p3dsRNA24a A 100.0
/100.0
21
/21
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[2] F p3dsRNA24b A 100.0
/100.0
19
/19
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
6gpg[1] A RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*CP*.. C 100.0
/99.8
19
/19
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
6gpg[1] B RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*CP*.. C 100.0
/99.8
29
/29
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4ay2[1] B 5'-R-PPP(GP*GP*CP*GP*CP*GP*GP*CP*UP*UP*CP*GP*GP*CP.. A 100.0
/99.7
31
/31
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
2ykg[4] B 5'-R(*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP)-3' A 100.0
/99.5
16
/16
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
2ykg[4] C 5'-R(*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP)-3' A 100.0
/99.5
16
/16
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
3og8[2] C RNA (5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*.. A 90.9
/99.2
11
/11
DDX58_HUMAN ATP-dependent RNA helicase DDX58
3og8[2] D RNA (5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*.. A 100.0
/99.2
4
/4
DDX58_HUMAN ATP-dependent RNA helicase DDX58
3lrn[2] C RNA (5'-R(*(GTP)P*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP.. A 93.3
/99.2
15
/15
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3lrn[2] D RNA (5'-R(*(GTP)P*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP.. A 100.0
/99.2
3
/3
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3lrr[2] C RNA (5'-R(*(ATP)P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*U).. A 93.3
/99.2
15
/15
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3lrr[2] D RNA (5'-R(*(ATP)P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*U).. A 100.0
/99.2
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4a36[1] C 5'-R(*GP*CP*AP*UP*GP*CP*GP*AP*CP*CP*UP*CP*UP*GP *U.. A 28.6
/60.0
7
/7
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a36[1] D 5'-R(*UP*CP*AP*AP*AP*CP*AP*GP*AP*GP*GP*UP*CP*GP *C.. A 70.8
/60.0
24
/24
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a36[1] E 5'-R(*GP*CP*AP*UP*GP*CP*GP*AP*CP*CP*UP*CP*UP*GP *U.. B 28.6
/59.7
7
/7
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a36[1] F 5'-R(*UP*CP*AP*AP*AP*CP*AP*GP*AP*GP*GP*UP*CP*GP *C.. B 72.0
/59.7
25
/25
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2x[2] E 5'-R(*GP*GP*GP*AP*GP*AP*AP*CP*AP*AP*CP*GP*CP*GP)-3.. A 88.9
/55.3
9
/9
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2x[2] E 5'-R(*GP*GP*GP*AP*GP*AP*AP*CP*AP*AP*CP*GP*CP*GP)-3.. B 100.0
/55.3
1
/1
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2x[2] F 5'-R(*CP*GP*CP*GP*UP*UP*GP*UP*UP*CP*UP*CP*CP*CP)-3.. A 0.0
/55.3
2
/2
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2x[2] F 5'-R(*CP*GP*CP*GP*UP*UP*GP*UP*UP*CP*UP*CP*CP*CP)-3.. B 88.9
/55.3
9
/9
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4gl2[2] C RNA (5'-R(*AP*UP*CP*CP*GP*CP*GP*GP*CP*CP*CP*U)-3').. A 46.2
/41.4
13
/14
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
4gl2[2] F RNA (5'-R(P*AP*GP*GP*GP*CP*CP*GP*CP*GP*GP*AP*U)-3'.. A 58.6
/41.4
29
/29
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl2[3] A RNA (44-MER) C 53.8
/40.2
13
/14
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl2[3] B RNA (44-MER) C 57.1
/40.2
21
/21
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
6gkh[1] B RNA (5'-R(P*GP*UP*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP.. A 50.0
/39.0
14
/15
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7nic[1] B RNA (5'-R(P*GP*UP*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP.. A 33.3
/38.8
18
/19
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gkh[2] C RNA (5'-R(P*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP*GP.. A 65.4
/39.0
26
/26
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7niq[1] B RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 50.0
/38.8
16
/18
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7niq[1] C RNA (5'-R(P*AP*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP.. A 63.6
/38.8
22
/22
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g1s[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 50.0
/39.6
14
/15
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g1x[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 50.0
/39.5
10
/11
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6h61[3] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 53.3
/39.2
15
/15
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkq[2] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 54.5
/38.6
11
/12
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7bkq[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 0.0
/38.6
2
/2
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7bkq[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 0.0
/38.6
2
/2
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
6g1s[1] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 69.2
/39.6
26
/26
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g1x[3] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 64.0
/39.5
25
/25
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6h61[3] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 70.4
/39.2
27
/27
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkq[1] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 100.0
/38.6
1
/1
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
6g19[1] B RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 47.4
/38.8
19
/21
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gjz[2] B RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 47.4
/38.8
19
/21
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkp[1] C RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 44.4
/38.3
18
/20
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g19[1] C RNA (5'-R(P*CP*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP.. A 58.6
/38.8
29
/29
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gjz[3] C RNA (5'-R(P*CP*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP.. A 60.0
/38.8
30
/30
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
5jaj[1] C RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 70.3
/35.4
37
/37
G0YYQ5_CHICK LGP2
5jc3[6] B RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 45.0
/38.1
20
/20
D9N195_CHICK Melanoma differentiation associated protein-5
5jc3[5] C RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 56.7
/38.1
30
/30
D9N195_CHICK Melanoma differentiation associated protein-5
5jc7[1] C RNA (5'-R(P*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP.. A 45.0
/38.0
20
/20
D9N195_CHICK Melanoma differentiation associated protein-5
5jc7[1] C RNA (5'-R(P*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP.. B 60.0
/37.9
30
/30
D9N195_CHICK Melanoma differentiation associated protein-5
5jc7[1] D RNA (5'-R(P*GP*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP.. A 58.1
/38.0
31
/31
D9N195_CHICK Melanoma differentiation associated protein-5
5jc7[1] D RNA (5'-R(P*GP*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP.. B 47.4
/37.9
19
/19
D9N195_CHICK Melanoma differentiation associated protein-5
5jcf[1] C RNA (5'-R(P*AP*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 62.1
/37.8
29
/29
D9N195_CHICK Melanoma differentiation associated protein-5
5jbj[1] B RNA (5'-R(P*GP*GP*UP*AP*GP*CP*GP*CP*UP*AP*CP*C)-3'.. A 30.8
/35.9
26
/26
G0YYQ5_CHICK LGP2
5jbj[1] C RNA (5'-R(P*GP*GP*UP*AP*GP*CP*GP*CP*UP*AP*CP*C)-3'.. A 70.6
/35.9
34
/34
G0YYQ5_CHICK LGP2
5jaj[1] B RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*CP*C)-3') A 30.8
/35.4
26
/26
G0YYQ5_CHICK LGP2
5jbg[1] B RNA (5'-R(*GPPP*GP*AP*GP*CP*GP*UP*GP*CP*CP*GP*GP*G.. A 44.8
/35.1
67
/67
G0YYQ5_CHICK LGP2
5jb2[1] B RNA (5'-R(*GPPP*GP*UP*AP*CP*GP*UP*AP*CP*CP*C)-3') .. A 30.8
/34.8
26
/26
G0YYQ5_CHICK LGP2
5jb2[1] C RNA (5'-R(*GPPP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 69.4
/34.8
36
/36
G0YYQ5_CHICK LGP2
6bu9[1] B RNA (5'-R(*GP*GP*AP*GP*GP*UP*AP*GP*UP*AP*GP*GP*UP*.. A 0.0
/33.7
1
/1
A1ZAW0_DROME Dicer-2, isoform A
7yym[3] B 59-nt precursor of miR-15a A 0.0
/33.7
1
/15
DICER_MOUSE Endoribonuclease Dicer
5zal[1] C RNA (73-mer) A 50.0
/32.8
4
/31
DICER_HUMAN Endoribonuclease Dicer
5zam[1] C RNA (73-mer) A 100.0
/32.8
2
/27
DICER_HUMAN Endoribonuclease Dicer
7v6c[1] C RNA (5'-R(P*UP*GP*AP*GP*G)-3') A 25.0
/32.5
4
/5
A1ZAW0_DROME Dicer-2, isoform A
7v6c[1] D RNA (5'-R(P*CP*CP*UP*CP*UP*CP*U)-3') A 57.1
/32.5
7
/8
A1ZAW0_DROME Dicer-2, isoform A
7eld[1] B pri-miRNA 166f A 26.5
/32.3
34
/74
DCL1_ARATH Endoribonuclease Dicer homolog 1
7ele[1] B pre-miRNA 166f A 25.8
/32.3
31
/63
DCL1_ARATH Endoribonuclease Dicer homolog 1
3eqt[2] C 5'-R(*GP*CP*GP*CP*GP*CP*GP*C)-3' A 40.0
/31.2
15
/15
DHX58_HUMAN ATP-dependent RNA helicase DHX58
3eqt[2] D 5'-R(*GP*CP*GP*CP*GP*CP*GP*C)-3' A 66.7
/31.2
6
/6
DHX58_HUMAN ATP-dependent RNA helicase DHX58
5v9x[1] B ssDNA A 23.1
/31.1
13
/52
A0A0D6HFY2_MYCSM ATP-dependent DNA helicase
7w0a[2] C RNA (30-MER) A 28.6
/29.7
7
/17
A1ZAW0_DROME Dicer-2, isoform A
7w0a[2] D RNA (32-MER) A 50.0
/29.7
22
/29
A1ZAW0_DROME Dicer-2, isoform A
7w0c[1] C RNA (35-MER) A 18.2
/29.7
11
/20
A1ZAW0_DROME Dicer-2, isoform A
7w0c[1] D RNA (35-MER) A 47.6
/29.7
21
/29
A1ZAW0_DROME Dicer-2, isoform A
7w0d[2] B dsRNA D 50.0
/29.7
20
/37
A1ZAW0_DROME Dicer-2, isoform A
7w0d[2] F dsRNA D 25.0
/29.7
8
/22
A1ZAW0_DROME Dicer-2, isoform A
7w0e[1] A dsRNA C 30.0
/29.7
10
/38
A1ZAW0_DROME Dicer-2, isoform A
7w0e[1] B dsRNA C 45.0
/29.7
20
/61
A1ZAW0_DROME Dicer-2, isoform A
7w0f[1] E siRNA A 27.3
/29.7
11
/19
A1ZAW0_DROME Dicer-2, isoform A
7w0f[1] F siRNA A 47.4
/29.7
19
/32
A1ZAW0_DROME Dicer-2, isoform A
8hf0[2] F RNA (52-MER) A 30.0
/29.7
10
/15
A1ZAW0_DROME Dicer-2, isoform A
8hf0[2] G RNA (52-MER) A 47.4
/29.7
19
/24
A1ZAW0_DROME Dicer-2, isoform A
8hf1[3] E RNA (5'-R(P*GP*AP*GP*AP*CP*UP*UP*GP*G)-3') A 42.9
/29.7
7
/13
A1ZAW0_DROME Dicer-2, isoform A
8hf1[3] H RNA (5'-R(P*CP*CP*AP*AP*GP*UP*CP*UP*CP*UP*U)-3') A 50.0
/29.7
18
/23
A1ZAW0_DROME Dicer-2, isoform A
8dfv[1] B RNA (60-MER) A 100.0
/24.1
1
/79
DCR1_DROME Endoribonuclease Dcr-1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
925 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3zd7[22] F ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/99.4
14
/14
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
6gkh[4] D ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 81.8
/39.0
11
/13
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6qv3[1] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 71.4
/31.9
7
/13
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
6qv3[1] D ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/31.9
1
/13
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
7jl0[4] F ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
C 80.0
/40.2
10
/11
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[4] E ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/100.0
10
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to2[3] E ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/100.0
12
/12
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
5f98[6] O M7G
7N-METHYL-8-HYDROGUANOSINE-5'-DIPHOSPHATE[29 atoms..
A 100.0
/100.0
7
/7
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[6] Q GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 100.0
/100.0
10
/10
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
8dvr[1] D GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 100.0
/100.0
10
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
3tbk[4] B ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 91.7
/78.8
12
/12
DDX58_MOUSE RIG-I Helicase Domain
5v9x[1] C ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 100.0
/31.1
6
/17
A0A0D6HFY2_MYCSM ATP-dependent DNA helicase
6gjz[1] E ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 77.8
/38.8
9
/10
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gkm[2] E ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 77.8
/38.5
9
/10
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6qv4[1] E AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..
A 75.0
/31.9
8
/17
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
6qv4[1] F AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..
A 33.3
/31.9
3
/16
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
925 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2qfb[10] K ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
2rqa[12] B ZN
ZINC ION[1 atoms]
A 83.3
/31.2
6
/6
DHX58_HUMAN ATP-dependent RNA helicase DHX58
2rqb[3] B ZN
ZINC ION[1 atoms]
A 80.0
/31.6
5
/5
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
2ykg[3] D ZN
ZINC ION[1 atoms]
A 100.0
/99.5
4
/4
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
3lrn[4] E ZN
ZINC ION[1 atoms]
A 100.0
/99.2
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3ncu[2] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
DDX58_HUMAN RIG-I
3og8[9] E ZN
ZINC ION[1 atoms]
A 100.0
/99.2
4
/4
DDX58_HUMAN ATP-dependent RNA helicase DDX58
4ay2[7] C ZN
ZINC ION[1 atoms]
A 100.0
/99.7
4
/4
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
4bpb[23] D ZN
ZINC ION[1 atoms]
A 100.0
/99.5
4
/4
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
4gl2[10] H ZN
ZINC ION[1 atoms]
A 80.0
/41.4
5
/5
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
5jaj[1] D ZN
ZINC ION[1 atoms]
A 100.0
/35.4
4
/4
G0YYQ5_CHICK LGP2
5jb2[3] D ZN
ZINC ION[1 atoms]
A 100.0
/34.8
4
/4
G0YYQ5_CHICK LGP2
6gjz[5] D ZN
ZINC ION[1 atoms]
A 100.0
/38.8
4
/4
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gpg[1] D ZN
ZINC ION[1 atoms]
C 100.0
/99.8
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7bkp[4] D ZN
ZINC ION[1 atoms]
A 100.0
/38.3
5
/5
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkq[2] D ZN
ZINC ION[1 atoms]
A 80.0
/38.6
5
/5
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7jl0[4] E ZN
ZINC ION[1 atoms]
C 100.0
/40.2
4
/4
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[4] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tnx[15] D ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
3zd7[1] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/99.4
2
/2
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
4a36[13] H MG
MAGNESIUM ION[1 atoms]
A 100.0
/60.0
5
/5
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4ay2[1] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/99.7
3
/3
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
5e3h[5] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5e3h[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5e3h[2] G MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] N MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[4] N MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[2] N MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] O MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] P MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] U MG
MAGNESIUM ION[1 atoms]
E 100.0
/100.0
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] X MG
MAGNESIUM ION[1 atoms]
G 100.0
/100.0
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5jaj[1] G MG
MAGNESIUM ION[1 atoms]
A 100.0
/35.4
2
/2
G0YYQ5_CHICK LGP2
5jb2[2] G MG
MAGNESIUM ION[1 atoms]
A 100.0
/34.8
2
/2
G0YYQ5_CHICK LGP2
5jb2[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/34.8
1
/1
G0YYQ5_CHICK LGP2
5v9x[1] H MG
MAGNESIUM ION[1 atoms]
A 100.0
/31.1
3
/3
A0A0D6HFY2_MYCSM ATP-dependent DNA helicase
6gkh[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/39.0
1
/1
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gpg[4] E MG
MAGNESIUM ION[1 atoms]
C 100.0
/99.8
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7bkp[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/38.3
1
/1
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7jl0[1] H MG
MAGNESIUM ION[1 atoms]
C 100.0
/40.2
1
/1
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7mk1[2] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
1
/1
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to2[3] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
4on9[1] G CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
6bzh[1] G CL
CHLORIDE ION[1 atoms]
A 66.7
/76.5
3
/3
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
6bzh[1] H CL
CHLORIDE ION[1 atoms]
A 100.0
/76.5
1
/1
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
6bzh[1] L CL
CHLORIDE ION[1 atoms]
D 0.0
/76.5
3
/3
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
3b6e[1] B NA
SODIUM ION[1 atoms]
A 100.0
/51.0
5
/5
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
6qv3[2] F MN
MANGANESE (II) ION[1 atoms]
A 100.0
/31.9
2
/2
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
2qfd[10] K HG
MERCURY (II) ION[1 atoms]
A 100.0
/100.0
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
2w4r[4] E HG
MERCURY (II) ION[1 atoms]
A 100.0
/31.5
4
/4
DHX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DHX58
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
925 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4on9[2] B DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[495 aa] A 100.0
/100.0
40
/40
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[18] C DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[648 aa] A 100.0
/100.0
20
/20
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] E DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[641 aa] A 100.0
/100.0
26
/26
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] G DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[647 aa] A 100.0
/100.0
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] K DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[644 aa] A 100.0
/100.0
3
/3
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] G DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[647 aa] C 100.0
/100.0
11
/11
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] K DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[644 aa] C 100.0
/100.0
3
/3
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7jl3[2] C DDX58_HUMAN Antiviral innate immune response receptor RIG-I[65.. A 100.0
/100.0
7
/7
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl3[2] E DDX58_HUMAN Antiviral innate immune response receptor RIG-I[65.. A 100.0
/100.0
6
/6
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[4] C DDX58_HUMAN Antiviral innate immune response receptor RIG-I[61.. A 100.0
/100.0
10
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7u[1] A DDX58_HUMAN Antiviral innate immune response receptor RIG-I[64.. C 100.0
/100.0
10
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[1] A DDX58_HUMAN Antiviral innate immune response receptor RIG-I[64.. C 100.0
/100.0
9
/9
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
4nqk[18] B DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[188 aa] A 100.0
/100.0
21
/21
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4nqk[12] D DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[188 aa] A 100.0
/100.0
12
/12
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4p4h[2] E DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[188 aa] A 100.0
/99.5
3
/3
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4p4h[8] H DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[188 aa] A 100.0
/99.5
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
6bzh[4] C DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58[191 aa] A 82.4
/76.5
17
/17
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
6bzh[4] D DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58[189 aa] A 72.7
/76.5
22
/22
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
7jl2[2] E IFIH1_HUMAN Interferon-induced helicase C domain-containing pr.. C 0.0
/40.2
9
/9
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl2[2] G IFIH1_HUMAN Interferon-induced helicase C domain-containing pr.. C 0.0
/40.2
7
/9
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7bkq[1] A IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-.. A 10.0
/38.6
10
/11
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7bkq[1] A IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-.. A 14.3
/38.6
7
/13
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
5jc7[2] B D9N195_CHICK Melanoma differentiation associated protein-5[647 .. A 35.0
/38.0
20
/21
D9N195_CHICK Melanoma differentiation associated protein-5
3eqt[2] B DHX58_HUMAN ATP-dependent RNA helicase DHX58[142 aa] A 0.0
/31.2
2
/2
DHX58_HUMAN ATP-dependent RNA helicase DHX58
7w0a[2] H A1ZAW0_DROME Dicer-2, isoform A[1478 aa] A 46.4
/29.7
28
/55
A1ZAW0_DROME Dicer-2, isoform A
7w0d[1] E A1ZAW0_DROME Dicer-2, isoform A[660 aa] D 0.0
/29.7
1
/6
A1ZAW0_DROME Dicer-2, isoform A
7w0d[1] D A1ZAW0_DROME Dicer-2, isoform A[1544 aa] E 0.0
/29.7
2
/8
A1ZAW0_DROME Dicer-2, isoform A
8hf0[1] A A1ZAW0_DROME Dicer-2, isoform A[1561 aa] D 40.0
/29.7
5
/13
A1ZAW0_DROME Dicer-2, isoform A
8hf1[2] D A1ZAW0_DROME Dicer-2, isoform A[1561 aa] A 0.0
/29.7
7
/28
A1ZAW0_DROME Dicer-2, isoform A
8hf1[2] A A1ZAW0_DROME Dicer-2, isoform A[1561 aa] D 33.3
/29.7
6
/31
A1ZAW0_DROME Dicer-2, isoform A
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
925 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5e3h[1] J BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
A 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] O ETF
TRIFLUOROETHANOL[6 atoms]
A 100.0
/100.0
9
/9
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] Y ETF
TRIFLUOROETHANOL[6 atoms]
E 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[2] CA ETF
TRIFLUOROETHANOL[6 atoms]
G 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] NA ETF
TRIFLUOROETHANOL[6 atoms]
K 100.0
/100.0
6
/6
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] P BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 100.0
/100.0
7
/7
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] Q BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[2] U BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] T BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
C 100.0
/100.0
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] V BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
C 100.0
/100.0
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[5] W BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
C 100.0
/100.0
8
/8
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[2] AA BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
E 100.0
/100.0
9
/9
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] EA BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
G 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3tbk[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/78.8
7
/7
DDX58_MOUSE RIG-I Helicase Domain
5jaj[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 60.0
/35.4
5
/5
G0YYQ5_CHICK LGP2
5jaj[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/35.4
4
/5
G0YYQ5_CHICK LGP2
5jaj[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/35.4
6
/6
G0YYQ5_CHICK LGP2
6bzh[2] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/76.5
2
/2
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
6bzh[1] I EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/76.5
1
/3
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
6bzh[1] J EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/76.5
2
/2
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
6bzh[1] J EDO
1,2-ETHANEDIOL[4 atoms]
C 75.0
/76.1
4
/4
DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58
4a36[2] I AF3
ALUMINUM FLUORIDE[4 atoms]
A 100.0
/60.0
9
/9
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
5jaj[1] F ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/35.4
8
/8
G0YYQ5_CHICK LGP2
5jb2[2] F ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/34.8
8
/8
G0YYQ5_CHICK LGP2
6gkh[3] E ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/39.0
6
/6
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7jl0[4] G ALF
TETRAFLUOROALUMINATE ION[5 atoms]
C 100.0
/40.2
6
/6
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[4] F ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/100.0
5
/5
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
5jaj[1] K MGF
TRIFLUOROMAGNESATE[4 atoms]
A 0.0
/35.4
1
/1
G0YYQ5_CHICK LGP2
2w4r[4] F SO4
SULFATE ION[5 atoms]
A 0.0
/31.5
3
/3
DHX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DHX58
2w4r[1] K SO4
SULFATE ION[5 atoms]
C 25.0
/31.9
4
/4
DHX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DHX58
2ykg[3] E SO4
SULFATE ION[5 atoms]
A 100.0
/99.5
7
/7
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
3ts9[1] B SO4
SULFATE ION[5 atoms]
A 100.0
/36.8
1
/1
IFIH1_MOUSE IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
3ts9[4] D SO4
SULFATE ION[5 atoms]
A 25.0
/36.8
4
/4
IFIH1_MOUSE IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
4on9[2] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4on9[2] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5jbg[1] G SO4
SULFATE ION[5 atoms]
A 50.0
/35.1
2
/3
G0YYQ5_CHICK LGP2
5jbg[1] H SO4
SULFATE ION[5 atoms]
A 33.3
/35.1
3
/3
G0YYQ5_CHICK LGP2
5jbg[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/35.1
1
/1
G0YYQ5_CHICK LGP2
5jbg[1] J SO4
SULFATE ION[5 atoms]
A 25.0
/35.1
4
/4
G0YYQ5_CHICK LGP2
6qws[1] C SO4
SULFATE ION[5 atoms]
A 100.0
/31.9
5
/5
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
6qws[1] E SO4
SULFATE ION[5 atoms]
A 100.0
/31.9
1
/3
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
5m59[4] I ACT
ACETATE ION[4 atoms]
B 83.3
/31.9
6
/6
G0S0B9_CHATD Pre-mRNA splicing helicase-like protein
4a2v[1] C GOL
GLYCEROL[6 atoms]
A 66.7
/55.3
6
/8
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2v[1] D GOL
GLYCEROL[6 atoms]
A 66.7
/55.3
3
/3
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
5e3h[1] H GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5v9x[1] E GOL
GLYCEROL[6 atoms]
A 0.0
/31.1
3
/9
A0A0D6HFY2_MYCSM ATP-dependent DNA helicase
5v9x[1] G GOL
GLYCEROL[6 atoms]
A 50.0
/31.1
2
/4
A0A0D6HFY2_MYCSM ATP-dependent DNA helicase
5v9x[1] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 33.3
/31.1
3
/5
A0A0D6HFY2_MYCSM ATP-dependent DNA helicase
1wp9[6] G PO4
PHOSPHATE ION[5 atoms]
A 85.7
/29.3
7
/7
Q8TZH8_PYRFU ATP-dependent RNA helicase, putative
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.