Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
4194 | 198 | 136 | YP_009725304.1() | |
QUERYSEQ |
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
198 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() ![]() |
1-198 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
198 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1A_SARS2 Non-structural protein 7[81 aa] | A | 100.0 /100.0 |
24 /24 |
R1A_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 7[70 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | D | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[832 aa] | B | 100.0 /100.0 |
36 /36 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[588 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
P | R1AB_SARS2 Proofreading exoribonuclease[524 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[37 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA product | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | RNA product | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (29-MER) | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (25-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (26-MER) | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | F | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (57-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (33-MER) | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
H | template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (37-MER) | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | RNA (43-MER) | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (36-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Template RNA (55-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
D | Product RNA (35-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Template RNA (55-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | template | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
1N7
|
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
EDO
|
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
ACY
|
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
ACY
|
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |