Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
3941126 | 500 | 8 | YP_009725300.1() | |
QUERYSEQ |
KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSAC VLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYY FMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNK YKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ |
500 | region | name | description |
1-500 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
500 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8yb7 | C | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
8yb7 | G | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
8yb7 | H | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
8yb7 | D | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
8yax | D | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
8yax | C | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
8yb5 | D | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
8yb5 | C | 100.0 | R1AB_SARS2 Non-structural protein 4 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
500 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | A | R1AB_SARS2 Papain-like protease nsp3[1314 aa] | C | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | B | R1AB_SARS2 Papain-like protease nsp3[543 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | F | R1AB_SARS2 Papain-like protease nsp3[361 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | F | R1AB_SARS2 Papain-like protease nsp3[361 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | F | R1AB_SARS2 Papain-like protease nsp3[361 aa] | C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | B | R1AB_SARS2 Papain-like protease nsp3[361 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | E | R1AB_SARS2 Papain-like protease nsp3[353 aa] | G | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | H | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | H | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | A | R1AB_SARS2 Papain-like protease nsp3[353 aa] | H | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | F | R1AB_SARS2 Papain-like protease nsp3[361 aa] | H | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | F | R1AB_SARS2 Papain-like protease nsp3[361 aa] | H | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | F | R1AB_SARS2 Papain-like protease nsp3[361 aa] | H | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
500 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yax | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | C | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb5 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | C | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | C | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | C | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | C | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | C | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | C | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | C | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | G | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | G | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | G | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | G | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | G | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | G | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | H | R1AB_SARS2 Non-structural protein 4[371 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | H | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | H | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | H | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | H | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | H | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | C | R1AB_SARS2 Non-structural protein 4[455 aa] | H | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | H | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | H | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | H | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | H | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | H | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | D | R1AB_SARS2 Non-structural protein 4[371 aa] | H | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | H | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | H | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | H | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | H | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | H | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 4 | |
8yb7 | G | R1AB_SARS2 Non-structural protein 4[454 aa] | H | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 4 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |