Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
3460 | 75 | 24 | P0DTC4(VEMP_SARS2) | RecName: Full=Envelope small membrane protein ; Short=E; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
75 | region | name | description |
1-75 | CHAIN | /note="Envelope small membrane protein" /id="PRO_0000449651" | |
1-13 | TOPO_DOM | /note="Virion surface" ECO:0000305|PubMed:32898469" | |
14-34 | TRANSMEM | /note="Helical" ECO:0000269|PubMed:33177698, ECO:0000305|PubMed:32898469" | |
35-75 | TOPO_DOM | /note="Intravirion" ECO:0000305|PubMed:32898469" | |
61-75 | REGION | /note="Disordered" |
MONOMER | |||||||
75 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8suz | D | 100.0 |