#WARNING:no index is registered index "YP_009724392.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724392.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
21375 75 18 YP_009724392.1()
QUERYSEQ
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724392.1()]

75
region name description

MONOMER
75
pdb_id a1 identity[%]2 description
2mm4 A 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 C 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 B 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 A 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 D 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 E 91.4 VEMP_CVHSA Envelope small membrane protein
8suz D 100.0 VEMP_SARS2 Envelope small membrane protein
8suz C 100.0 VEMP_SARS2 Envelope small membrane protein
8suz B 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g D 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g C 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g E 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g B 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g A 100.0 VEMP_SARS2 Envelope small membrane protein
8suz E 100.0 VEMP_SARS2 Envelope small membrane protein
8suz A 100.0 VEMP_SARS2 Envelope small membrane protein
8u1t A 100.0 VEMP_SARS2 Envelope small membrane protein
8u1t B 100.0 VEMP_SARS2 Envelope small membrane protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.