Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
20479 | 180 | 45 | Q10589(BST2_HUMAN) | RecName: Full=Bone marrow stromal antigen 2; Short=BST-2;AltName: Full=HM1.24 antigen;AltName: Full=Tetherin;AltName: CD_antigen=CD317;Flags: Precursor; |
QUERYSEQ |
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD KKYYPSSQDSSSAAAPQLLIVLLGLSALLQ |
180 | region | name | description |
1-161 | CHAIN | /note="Bone marrow stromal antigen 2" /id="PRO_0000065005" | |
162-180 | PROPEP | /note="Removed in mature form" /id="PRO_0000253552" | |
1-20 | TOPO_DOM | /note="Cytoplasmic" | |
21-48 | TRANSMEM | /note="Helical; Signal-anchor for type II membrane protein" | |
49-161 | TOPO_DOM | /note="Extracellular" | |
68-152 | COILED | ||
161-161 | LIPID | /note="GPI-anchor amidated serine" | |
1-163 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
180 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
3mqb | A | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mqb | B | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mqb | C | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3nwh | B | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3nwh | A | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3nwh | C | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mqb | D | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3nwh | D | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mqc | A | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mqc | D | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mqc | C | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mqc | B | 100.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | B | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | C | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | I | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | G | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | F | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | E | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | D | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | L | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | K | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | J | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | H | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq7 | A | 97.0 | BST2_HUMAN Bone marrow stromal antigen 2 | ||||
3mq9 | C | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
3mq9 | D | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
3mq9 | H | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
3mq9 | G | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
3mq9 | F | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
3mq9 | E | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
3mq9 | B | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
3mq9 | A | 96.6 | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein | ||||
2xg7 | A | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2xg7 | B | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | A | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | B | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | J | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | I | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | F | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | E | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | D | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | H | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | G | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | C | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
2x7a | K | 100.0 | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
COMPOUND | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2xg7 | C |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2xg7 | D |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2xg7 | C |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2xg7 | D |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
2 /2 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2x7a | M |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | M |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | O |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | Q |
CL
CHLORIDE ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | T |
CL
CHLORIDE ION[1 atoms] |
G | 100.0 /100.0 |
3 /3 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | W |
CL
CHLORIDE ION[1 atoms] |
H | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | AA |
CL
CHLORIDE ION[1 atoms] |
I | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | L |
NA
SODIUM ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | P |
NA
SODIUM ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | P |
NA
SODIUM ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | U |
NA
SODIUM ION[1 atoms] |
G | 100.0 /100.0 |
2 /2 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | Y |
NA
SODIUM ION[1 atoms] |
I | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | Z |
NA
SODIUM ION[1 atoms] |
I | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | X |
MG
MAGNESIUM ION[1 atoms] |
I | 100.0 /100.0 |
2 /2 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | X |
MG
MAGNESIUM ION[1 atoms] |
J | 100.0 /100.0 |
2 /2 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
3mq7 | M |
CA
CALCIUM ION[1 atoms] |
E | 100.0 /97.0 |
2 /2 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | M |
CA
CALCIUM ION[1 atoms] |
E | 100.0 /97.0 |
2 /2 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | N |
CA
CALCIUM ION[1 atoms] |
K | 100.0 /97.0 |
2 /2 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | N |
CA
CALCIUM ION[1 atoms] |
K | 100.0 /97.0 |
2 /2 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2x7a | B | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[59 aa] | A | 100.0 /100.0 |
25 /25 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | A | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[59 aa] | B | 95.8 /100.0 |
24 /24 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | D | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[56 aa] | C | 100.0 /100.0 |
17 /17 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | C | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[48 aa] | D | 95.2 /100.0 |
21 /21 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | F | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[59 aa] | E | 100.0 /100.0 |
24 /24 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | E | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[59 aa] | F | 96.0 /100.0 |
25 /25 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | H | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[54 aa] | G | 100.0 /100.0 |
24 /24 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | G | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[54 aa] | H | 95.8 /100.0 |
24 /24 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | J | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[59 aa] | I | 96.4 /100.0 |
28 /28 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | I | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[59 aa] | J | 100.0 /100.0 |
26 /26 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | K | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[39 aa] | K | 88.9 /100.0 |
9 /9 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2x7a | K | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[39 aa] | K | 88.9 /100.0 |
9 /9 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2xg7 | B | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[75 aa] | A | 100.0 /100.0 |
36 /36 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
2xg7 | A | BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2[82 aa] | B | 100.0 /100.0 |
27 /27 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
3mq7 | B | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 93.3 /97.0 |
30 /30 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | C | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 81.2 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | D | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | F | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 88.9 /97.0 |
9 /9 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 100.0 /97.0 |
3 /3 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | A | 85.7 /97.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | B | 96.8 /97.0 |
31 /31 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | C | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | B | 87.5 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | D | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | B | 78.6 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | B | 100.0 /97.0 |
4 /4 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | B | 85.7 /97.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | C | 80.0 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | B | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | C | 87.5 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | D | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | C | 96.8 /97.0 |
31 /31 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | C | 83.3 /97.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | C | 88.9 /97.0 |
9 /9 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | C | 100.0 /97.0 |
2 /2 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | C | 100.0 /97.0 |
4 /4 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | D | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | B | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | D | 80.0 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | C | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | D | 96.2 /97.0 |
26 /26 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | D | 80.0 /97.0 |
5 /5 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | D | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | F | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 96.7 /97.0 |
30 /30 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | F | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 96.7 /97.0 |
30 /30 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 78.6 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 78.6 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 100.0 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | E | 100.0 /97.0 |
11 /11 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | F | 85.7 /97.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | F | 96.6 /97.0 |
29 /29 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | F | 96.6 /97.0 |
29 /29 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | F | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | F | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | F | 81.2 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | F | 81.2 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 87.5 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 87.5 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | F | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 87.5 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | F | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 87.5 /97.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 93.5 /97.0 |
31 /31 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 93.5 /97.0 |
31 /31 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 100.0 /97.0 |
3 /3 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | G | 100.0 /97.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 100.0 /97.0 |
4 /4 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | C | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 87.5 /97.0 |
8 /8 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | F | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | F | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 93.8 /97.0 |
32 /32 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 93.8 /97.0 |
32 /32 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | H | 100.0 /97.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 100.0 /97.0 |
13 /13 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 66.7 /97.0 |
3 /3 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 93.3 /97.0 |
30 /30 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 93.3 /97.0 |
30 /30 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 78.6 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 78.6 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | I | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | B | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 100.0 /97.0 |
3 /3 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | C | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 85.7 /97.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | D | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 83.3 /97.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 93.1 /97.0 |
29 /29 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 93.1 /97.0 |
29 /29 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 85.7 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 80.0 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | J | 80.0 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | C | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 100.0 /97.0 |
2 /2 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | E | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 90.9 /97.0 |
11 /11 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | G | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 100.0 /97.0 |
5 /5 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 88.2 /97.0 |
17 /17 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 88.2 /97.0 |
17 /17 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 92.9 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 92.9 /97.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 97.0 /97.0 |
33 /33 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | L | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | K | 97.0 /97.0 |
33 /33 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | A | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 87.5 /97.0 |
8 /8 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | B | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 87.5 /97.0 |
8 /8 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | C | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 100.0 /97.0 |
4 /4 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | D | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 100.0 /97.0 |
1 /1 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | H | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 100.0 /97.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | I | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 86.7 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 80.0 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | J | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 80.0 /97.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 100.0 /97.0 |
29 /29 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq7 | K | BST2_HUMAN Bone marrow stromal antigen 2[99 aa] | L | 100.0 /97.0 |
29 /29 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | A | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | A | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | B | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | A | 100.0 /100.0 |
32 /32 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | B | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | A | 100.0 /100.0 |
13 /13 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | B | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | A | 100.0 /100.0 |
13 /13 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | B | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | A | 100.0 /100.0 |
32 /32 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | A | 100.0 /100.0 |
10 /10 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | A | 100.0 /100.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | B | 100.0 /100.0 |
35 /35 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | B | 100.0 /100.0 |
13 /13 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | B | 100.0 /100.0 |
13 /13 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | B | 100.0 /100.0 |
35 /35 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | B | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | B | 100.0 /100.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | B | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | B | 100.0 /100.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | B | 100.0 /100.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | C | 100.0 /100.0 |
10 /10 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | B | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | C | 100.0 /100.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | C | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | C | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | C | 100.0 /100.0 |
32 /32 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | C | 100.0 /100.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | C | 100.0 /100.0 |
32 /32 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | C | 100.0 /100.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | C | 100.0 /100.0 |
32 /32 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | A | BST2_HUMAN Bone marrow stromal antigen 2[109 aa] | D | 100.0 /100.0 |
3 /3 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | D | 100.0 /100.0 |
34 /34 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | D | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | D | 100.0 /100.0 |
34 /34 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | D | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | C | BST2_HUMAN Bone marrow stromal antigen 2[106 aa] | D | 100.0 /100.0 |
34 /34 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | D | 100.0 /100.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqb | D | BST2_HUMAN Bone marrow stromal antigen 2[102 aa] | D | 100.0 /100.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | B | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | A | 97.0 /100.0 |
33 /33 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | B | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | A | 100.0 /100.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | C | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | A | 94.7 /100.0 |
19 /19 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | D | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | A | 100.0 /100.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | D | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | A | 100.0 /100.0 |
10 /10 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | A | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | B | 97.0 /100.0 |
33 /33 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | A | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | B | 100.0 /100.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | C | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | B | 100.0 /100.0 |
14 /14 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | C | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | B | 66.7 /100.0 |
3 /3 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | D | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | B | 94.4 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | D | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | B | 94.4 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | A | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | C | 100.0 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | B | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | C | 100.0 /100.0 |
12 /12 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | B | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | C | 66.7 /100.0 |
3 /3 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | D | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | C | 97.0 /100.0 |
33 /33 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | D | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | C | 100.0 /100.0 |
7 /7 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | A | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | D | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | A | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | D | 100.0 /100.0 |
10 /10 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | B | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | D | 94.4 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | B | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | D | 94.4 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | C | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | D | 97.1 /100.0 |
34 /34 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mqc | C | BST2_HUMAN Bone marrow stromal antigen 2[100 aa] | D | 100.0 /100.0 |
6 /6 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | B | BST2_HUMAN Bone marrow stromal antigen 2[105 aa] | A | 94.4 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | C | BST2_HUMAN Bone marrow stromal antigen 2[104 aa] | A | 96.7 /100.0 |
30 /30 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | D | BST2_HUMAN Bone marrow stromal antigen 2[101 aa] | A | 100.0 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | A | BST2_HUMAN Bone marrow stromal antigen 2[105 aa] | B | 100.0 /100.0 |
17 /17 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | C | BST2_HUMAN Bone marrow stromal antigen 2[104 aa] | B | 100.0 /100.0 |
12 /12 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | D | BST2_HUMAN Bone marrow stromal antigen 2[101 aa] | B | 96.0 /100.0 |
25 /25 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | A | BST2_HUMAN Bone marrow stromal antigen 2[105 aa] | C | 96.8 /100.0 |
31 /31 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | B | BST2_HUMAN Bone marrow stromal antigen 2[105 aa] | C | 100.0 /100.0 |
15 /15 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | D | BST2_HUMAN Bone marrow stromal antigen 2[101 aa] | C | 94.4 /100.0 |
18 /18 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | A | BST2_HUMAN Bone marrow stromal antigen 2[105 aa] | D | 100.0 /100.0 |
16 /16 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | B | BST2_HUMAN Bone marrow stromal antigen 2[105 aa] | D | 100.0 /100.0 |
31 /31 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3nwh | C | BST2_HUMAN Bone marrow stromal antigen 2[104 aa] | D | 94.7 /100.0 |
19 /19 |
BST2_HUMAN Bone marrow stromal antigen 2 | |
3mq9 | B | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | A | 79.3 /96.6 |
29 /46 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | C | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | A | 88.9 /96.6 |
18 /27 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | D | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | A | 96.3 /96.6 |
27 /27 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | A | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | B | 81.5 /96.6 |
27 /45 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | C | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | B | 95.8 /96.6 |
24 /24 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | D | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | B | 87.5 /96.6 |
16 /27 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | A | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | C | 87.0 /96.6 |
23 /30 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | B | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | C | 95.8 /96.6 |
24 /24 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | D | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | C | 87.5 /96.6 |
16 /20 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | A | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | D | 95.8 /96.6 |
24 /24 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | B | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | D | 91.3 /96.6 |
23 /29 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | C | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | D | 83.3 /96.6 |
18 /18 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | F | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | E | 82.1 /96.6 |
28 /45 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | G | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | E | 84.6 /96.6 |
13 /22 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | H | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | E | 92.0 /96.6 |
25 /25 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | E | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | F | 80.0 /96.6 |
25 /42 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | G | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | F | 92.0 /96.6 |
25 /25 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | H | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | F | 86.7 /96.6 |
15 /26 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | E | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | G | 90.5 /96.6 |
21 /27 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | F | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | G | 95.8 /96.6 |
24 /24 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | H | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | G | 87.5 /96.6 |
16 /16 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | E | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | H | 95.5 /96.6 |
22 /22 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | F | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | H | 90.5 /96.6 |
21 /27 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3mq9 | G | MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | H | 87.5 /96.6 |
16 /16 |
MALE_ECOLI BST2_HUMAN Bone marrow stromal antigen 2 fused to Maltose-bin.. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
180 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2x7a | R |
GOL
GLYCEROL[6 atoms] |
G | 100.0 /100.0 |
1 /1 |
BST2_HUMAN BONE MARROW STROMAL ANTIGEN 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |