#WARNING:no index is registered index "YP_009725309.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725309.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
19863 527 92 YP_009725309.1()
QUERYSEQ 
AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLI
PLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDS
PCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725309.1()]

527
region name description
1-10 DISORDER predicted by DISOPRED

MONOMER
527
pdb_id a1 identity[%]2 description
7egq P 100.0 R1AB_SARS2 Proofreading exoribonuclease 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7eiz[1] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7eiz[1] E R1AB_SARS2 Non-structural protein 9[113 aa] I 100.0
/100.0		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
5c8s[14] A R1AB_CVHSA Non-structural protein 10[133 aa] B 98.0
/94.9		 49
/49		 R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7qif[1] B GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52.. 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5c8s[4] K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] 		B 100.0
/94.9		 14
/14		 R1AB_CVHSA Guanine-N7 methyltransferase
7tw8[1] B SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] 		A 100.0
/98.9		 13
/13		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
8frj[1] C AW2
5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]a.. 		A 100.0
/98.9		 16
/16		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
5c8t[2] K SAM
S-ADENOSYLMETHIONINE[27 atoms] 		B 100.0
/94.9		 13
/13		 R1AB_CVHSA Guanine-N7 methyltransferase
7tw7[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms] 		A 100.0
/98.9		 13
/13		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] B SFG
SINEFUNGIN[27 atoms] 		A 100.0
/98.9		 13
/13		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
8frk[1] D MJ7
5'-S-(4-{[(4'-chloro[1,1'-biphenyl]-3-yl)methyl]am.. 		A 100.0
/98.9		 14
/14		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
8bwu[1] B 6NR
(2~{S})-2-azanyl-4-[[(2~{S},3~{S},4~{R},5~{R})-5-(.. 		A 100.0
/97.4		 13
/13		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
5c8s[2] L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms.. 		B 100.0
/94.9		 16
/16		 R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7mc5[1] V CL
CHLORIDE ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
5c8s[2] J MG
MAGNESIUM ION[1 atoms] 		B 100.0
/94.9		 3
/3		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] J MG
MAGNESIUM ION[1 atoms] 		B 100.0
/94.9		 3
/3		 R1AB_CVHSA Guanine-N7 methyltransferase
7diy[1] G MG
MAGNESIUM ION[1 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 nsp14-ExoN protein
7eiz[1] S MG
MAGNESIUM ION[1 atoms] 		I 100.0
/100.0		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] M MG
MAGNESIUM ION[1 atoms] 		A 100.0
/99.6		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
5c8s[5] G ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[5] H ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[5] I ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[5] G ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[5] H ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] I ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] I ZN
ZINC ION[1 atoms] 		A 100.0
/94.7		 5
/5		 Q1T6X8_CVHSA Polyprotein 1ab
5nfy[4] J ZN
ZINC ION[1 atoms] 		A 100.0
/94.7		 4
/4		 Q1T6X8_CVHSA Polyprotein 1ab
5nfy[4] K ZN
ZINC ION[1 atoms] 		A 100.0
/94.7		 5
/5		 Q1T6X8_CVHSA Polyprotein 1ab
7diy[2] E ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp14-ExoN protein
7diy[7] F ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp14-ExoN protein
7mc5[1] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7qgi[2] B ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7qgi[2] C ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7qgi[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] I ZN
ZINC ION[1 atoms] 		A 100.0
/99.5		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[2] J ZN
ZINC ION[1 atoms] 		A 100.0
/99.5		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
8frk[1] E K
POTASSIUM ION[1 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7qgi[2] E PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7qgi[2] F PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7mc5[1] P TLA
L(+)-TARTARIC ACID[10 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] Q TLA
L(+)-TARTARIC ACID[10 atoms] 		A 100.0
/99.7		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] AA EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] DA EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[4] E EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] H EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] I EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] J EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] K EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] L EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] M EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[2] N EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] O EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] R EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[2] T EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] U EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] W EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] E EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] K EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] P EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
7r2v[1] E TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] 		A 100.0
/99.5		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5nfy[2] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/94.7		 2
/2		 Q1T6X8_CVHSA Polyprotein 1ab
7r2v[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/99.5		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] K PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/99.5		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] N PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/99.5		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7tw9[1] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/98.9		 6
/6		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] E EOH
ETHANOL[3 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[2] F MOH
METHANOL[2 atoms] 		A 100.0
/98.9		 3
/3		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] I MOH
METHANOL[2 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] J MOH
METHANOL[2 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.