Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1538088 | 221 | 12 | P59596(VME1_SARS) | RecName: Full=Membrane protein ; Short=M protein ;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ; |
QUERYSEQ |
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRM AGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ |
221 | region | name | description |
1-221 | CHAIN | /note="Membrane protein" /id="PRO_0000106035" | |
1-18 | TOPO_DOM | /note="Virion surface" | |
19-39 | TRANSMEM | /note="Helical" | |
40-49 | TOPO_DOM | /note="Intravirion" | |
50-70 | TRANSMEM | /note="Helical" | |
71-78 | TOPO_DOM | /note="Virion surface" | |
79-99 | TRANSMEM | /note="Helical" | |
100-221 | TOPO_DOM | /note="Intravirion" | |
1-6 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
221 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7vgr | E | 91.4 | VME1_SARS2 Membrane protein | ||||
7vgr | F | 91.4 | VME1_SARS2 Membrane protein | ||||
7vgs | A | 91.3 | VME1_SARS2 Membrane protein | ||||
7vgs | D | 91.3 | VME1_SARS2 Membrane protein | ||||
8ctk | A | 91.5 | VME1_SARS2 Membrane protein | ||||
8ctk | B | 91.5 | VME1_SARS2 Membrane protein | ||||
7y9b | A | 45.9 | VME1_BCHK5 Membrane protein | ||||
7y9b | B | 45.9 | VME1_BCHK5 Membrane protein | ||||
7y9b | D | 45.9 | VME1_BCHK5 Membrane protein | ||||
7y9b | C | 45.9 | VME1_BCHK5 Membrane protein | ||||
7y96 | B | 47.7 | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | ||||
7y96 | A | 47.6 | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
221 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7vgr | A | YN7756_1 Fab light chain[218 aa] | E | 100.0 /91.4 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgr | C | YN7756_1 Fab light chain[218 aa] | E | 100.0 /91.4 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgr | A | YN7756_1 Fab light chain[218 aa] | F | 100.0 /91.4 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgr | C | YN7756_1 Fab light chain[218 aa] | F | 100.0 /91.4 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgr | B | YN7756_1 Fab heavy chain[220 aa] | E | 88.9 /91.4 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgr | D | YN7756_1 Fab heavy chain[220 aa] | E | 50.0 /91.4 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgr | B | YN7756_1 Fab heavy chain[220 aa] | F | 50.0 /91.4 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgr | D | YN7756_1 Fab heavy chain[220 aa] | F | 88.9 /91.4 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgs | B | YN7717_9 Fab light chain[218 aa] | A | 88.9 /91.3 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgs | E | YN7717_9 Fab light chain[218 aa] | A | 66.7 /91.3 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgs | B | YN7717_9 Fab light chain[218 aa] | D | 66.7 /91.3 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgs | E | YN7717_9 Fab light chain[218 aa] | D | 88.9 /91.3 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgs | C | YN7717_9 Fab heavy chain[213 aa] | A | 100.0 /91.3 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgs | F | YN7717_9 Fab heavy chain[213 aa] | D | 100.0 /91.3 |
9 /9 |
VME1_SARS2 Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
221 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7y9b | E |
N8E
3,6,9,12,15-PENTAOXATRICOSAN-1-OL[24 atoms] |
A | 25.0 /45.9 |
4 /4 |
VME1_BCHK5 Membrane protein | |
7y9b | F |
N8E
3,6,9,12,15-PENTAOXATRICOSAN-1-OL[24 atoms] |
A | 0.0 /45.9 |
2 /2 |
VME1_BCHK5 Membrane protein | |
7y9b | G |
N8E
3,6,9,12,15-PENTAOXATRICOSAN-1-OL[24 atoms] |
C | 0.0 /45.9 |
2 /2 |
VME1_BCHK5 Membrane protein | |
7y9b | H |
N8E
3,6,9,12,15-PENTAOXATRICOSAN-1-OL[24 atoms] |
C | 28.6 /45.9 |
7 /7 |
VME1_BCHK5 Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
221 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7vgr | F | VME1_SARS2 Membrane protein[198 aa] | E | 93.5 /91.4 |
46 /46 |
VME1_SARS2 Membrane protein | |
7vgr | E | VME1_SARS2 Membrane protein[198 aa] | F | 93.5 /91.4 |
46 /46 |
VME1_SARS2 Membrane protein | |
7vgs | D | VME1_SARS2 Membrane protein[196 aa] | A | 92.5 /91.3 |
40 /40 |
VME1_SARS2 Membrane protein | |
7vgs | A | VME1_SARS2 Membrane protein[196 aa] | D | 92.5 /91.3 |
40 /40 |
VME1_SARS2 Membrane protein | |
8ctk | B | VME1_SARS2 Membrane protein[188 aa] | A | 86.1 /91.5 |
36 /36 |
VME1_SARS2 Membrane protein | |
8ctk | A | VME1_SARS2 Membrane protein[188 aa] | B | 86.5 /91.5 |
37 /37 |
VME1_SARS2 Membrane protein | |
7y96 | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 56.7 /47.6 |
30 /38 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 36.4 /47.6 |
11 /11 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 36.4 /47.6 |
11 /11 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 56.7 /47.6 |
30 /38 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | A | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[310 aa].. | B | 59.4 /47.7 |
32 /40 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | A | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[310 aa].. | B | 20.0 /47.7 |
5 /9 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | A | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[310 aa].. | B | 20.0 /47.7 |
5 /9 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | A | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[310 aa].. | B | 59.4 /47.7 |
32 /40 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | B | 43.9 /47.7 |
41 /41 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96 | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | B | 43.9 /47.7 |
41 /41 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y9b | B | VME1_BCHK5 Membrane protein[187 aa] | A | 44.8 /45.9 |
58 /58 |
VME1_BCHK5 Membrane protein | |
7y9b | A | VME1_BCHK5 Membrane protein[187 aa] | B | 46.4 /45.9 |
56 /56 |
VME1_BCHK5 Membrane protein | |
7y9b | D | VME1_BCHK5 Membrane protein[187 aa] | C | 44.8 /45.9 |
58 /58 |
VME1_BCHK5 Membrane protein | |
7y9b | C | VME1_BCHK5 Membrane protein[187 aa] | D | 47.3 /45.9 |
55 /55 |
VME1_BCHK5 Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |