Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3177197 75 30 P0DTC4(VEMP_SARS2) RecName: Full=Envelope small membrane protein ; Short=E; Short=sM protein ;
QUERYSEQ 
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC4(VEMP_SARS2)]

75
region name description
1-75 CHAIN /note="Envelope small membrane protein" /id="PRO_0000449651"
1-13 TOPO_DOM /note="Virion surface" ECO:0000305|PubMed:32898469"
14-34 TRANSMEM /note="Helical" ECO:0000269|PubMed:33177698, ECO:0000305|PubMed:32898469"
35-75 TOPO_DOM /note="Intravirion" ECO:0000305|PubMed:32898469"
61-75 REGION /note="Disordered"

MONOMER
75
pdb_id a1 identity[%]2 description
2mm4 A 91.4 VEMP_CVHSA Envelope small membrane protein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
75 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7m4r[1] A MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5[360 aa] C 100.0
/100.0		 5
/5		 VEMP_SARS2 Envelope small membrane protein
7ntk[4] A MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] C 100.0
/100.0		 6
/6		 VEMP_SARS2 Envelope small membrane protein
7qcs[2] A PALS1_HUMAN Protein PALS1[97 aa] C 100.0
/100.0		 4
/4		 VEMP_SARS2 Envelope small membrane protein
7qcr[4] A AFAD_HUMAN Afadin[87 aa] C 100.0
/100.0		 2
/2		 VEMP_SARS2 Envelope small membrane protein
7qct[2] A LNX2_HUMAN Ligand of Numb protein X 2[90 aa] C 100.0
/100.0		 5
/5		 VEMP_SARS2 Envelope small membrane protein
7tuq[1] A BRD4_HUMAN Bromodomain-containing protein 4[124 aa] C 66.7
/66.7		 3
/3		 VEMP_SARS2 Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
75 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k3g[22] B VEMP_SARS2 Envelope small membrane protein[31 aa] A 100.0
/100.0		 12
/12		 VEMP_SARS2 Envelope small membrane protein
5x29[5] B VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/91.4		 9
/9		 VEMP_CVHSA Envelope small membrane protein
5x29[5] E VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/91.4		 6
/6		 VEMP_CVHSA Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
75 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7ntk[1] M EDO
1,2-ETHANEDIOL[4 atoms] 		E 100.0
/100.0		 1
/1		 VEMP_SARS2 Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.