Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
5461 | 121 | 9 | P0DTC8(NS8_SARS2) | RecName: Full=ORF8 protein; Short=ORF8;AltName: Full=Non-structural protein 8; Short=ns8;Flags: Precursor; |
QUERYSEQ |
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
121 | region | name | description |
1-15 | SIGNAL | ||
16-121 | CHAIN | /note="ORF8 protein" /id="PRO_0000449655" | |
19-121 | DOMAIN | /note="SARS ORF8 Ig-like" | |
1-9 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
121 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7jx6 | A | 100.0 | NS8_SARS2 ORF8 protein | ||||
7f5f | A | 99.0 | A0A6B9VKN0_SARS2 ORF8 protein | ||||
7xmn | B | 100.0 | NS8_SARS2 ORF8 protein | ||||
7jtl | A | 100.0 | NS8_SARS2 ORF8 protein | ||||
7f8l | B | 97.1 | A0A6B9WE90_SARS Nonstructural protein NS8 | ||||
7f8l | A | 97.1 | A0A6B9WE90_SARS Nonstructural protein NS8 | ||||
7jtl | B | 100.0 | NS8_SARS2 ORF8 protein | ||||
7jx6 | B | 100.0 | NS8_SARS2 ORF8 protein | ||||
7mx9 | A | 98.9 | NS8_SARS2 ORF8 protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
121 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7xmn | A | A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa] | B | 100.0 /100.0 |
9 /9 |
NS8_SARS2 ORF8 protein | |
7xmn | A | A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa] | B | 100.0 /100.0 |
17 /17 |
NS8_SARS2 ORF8 protein | |
7xmn | A | A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa] | B | 100.0 /100.0 |
17 /17 |
NS8_SARS2 ORF8 protein | |
7xmn | A | A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa] | B | 100.0 /100.0 |
9 /9 |
NS8_SARS2 ORF8 protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
121 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7xmn | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7xmn | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7xmn | I |
NNH
NOR-N-OMEGA-HYDROXY-L-ARGININE[12 atoms] |
B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7xmn | I |
NNH
NOR-N-OMEGA-HYDROXY-L-ARGININE[12 atoms] |
B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
121 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7jtl | C |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein | |
7jx6 | C |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7jx6 | C |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NS8_SARS2 ORF8 protein | |
7jx6 | C |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NS8_SARS2 ORF8 protein | |
7jx6 | C |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7jx6 | D |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein | |
7jx6 | D |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein | |
7jx6 | E |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein | |
7jx6 | E |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein | |
7jx6 | F |
NA
SODIUM ION[1 atoms] |
B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7jx6 | F |
NA
SODIUM ION[1 atoms] |
B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7f5f | B |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /99.0 |
2 /2 |
A0A6B9VKN0_SARS2 ORF8 protein | |
7f8l | C |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /97.1 |
2 /2 |
A0A6B9WE90_SARS Nonstructural protein NS8 | |
7f8l | D |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /97.1 |
2 /2 |
A0A6B9WE90_SARS Nonstructural protein NS8 | |
7f8l | E |
CA
CALCIUM ION[1 atoms] |
B | 100.0 /97.1 |
3 /3 |
A0A6B9WE90_SARS Nonstructural protein NS8 | |
7f8l | F |
CA
CALCIUM ION[1 atoms] |
B | 100.0 /97.1 |
2 /2 |
A0A6B9WE90_SARS Nonstructural protein NS8 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
121 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7f8l | B | A0A6B9WE90_SARS Nonstructural protein NS8[104 aa] | A | 100.0 /97.1 |
15 /15 |
A0A6B9WE90_SARS Nonstructural protein NS8 | |
7f8l | A | A0A6B9WE90_SARS Nonstructural protein NS8[104 aa] | B | 100.0 /97.1 |
15 /15 |
A0A6B9WE90_SARS Nonstructural protein NS8 | |
7jtl | B | NS8_SARS2 ORF8 protein[101 aa] | A | 100.0 /100.0 |
15 /15 |
NS8_SARS2 ORF8 protein | |
7jtl | A | NS8_SARS2 ORF8 protein[102 aa] | B | 100.0 /100.0 |
18 /18 |
NS8_SARS2 ORF8 protein | |
7jx6 | A | NS8_SARS2 ORF8 protein[104 aa] | A | 100.0 /100.0 |
14 /14 |
NS8_SARS2 ORF8 protein | |
7jx6 | A | NS8_SARS2 ORF8 protein[104 aa] | A | 100.0 /100.0 |
14 /14 |
NS8_SARS2 ORF8 protein | |
7jx6 | A | NS8_SARS2 ORF8 protein[104 aa] | B | 100.0 /100.0 |
16 /16 |
NS8_SARS2 ORF8 protein | |
7jx6 | A | NS8_SARS2 ORF8 protein[104 aa] | B | 100.0 /100.0 |
7 /7 |
NS8_SARS2 ORF8 protein | |
7jx6 | A | NS8_SARS2 ORF8 protein[104 aa] | B | 100.0 /100.0 |
7 /7 |
NS8_SARS2 ORF8 protein | |
7jx6 | A | NS8_SARS2 ORF8 protein[104 aa] | B | 100.0 /100.0 |
16 /16 |
NS8_SARS2 ORF8 protein | |
7xmn | B | NS8_SARS2 ORF8 protein[102 aa] | B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7xmn | B | NS8_SARS2 ORF8 protein[102 aa] | B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7jx6 | B | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /100.0 |
17 /17 |
NS8_SARS2 ORF8 protein | |
7jx6 | B | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7jx6 | B | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein | |
7jx6 | B | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /100.0 |
17 /17 |
NS8_SARS2 ORF8 protein | |
7mx9 | A | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /98.9 |
13 /13 |
NS8_SARS2 ORF8 protein | |
7mx9 | A | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /98.9 |
13 /13 |
NS8_SARS2 ORF8 protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
121 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7xmn | E |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
3 /3 |
NS8_SARS2 ORF8 protein | |
7xmn | E |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
3 /3 |
NS8_SARS2 ORF8 protein | |
7xmn | J |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein | |
7xmn | J |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein | |
7xmn | K |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
5 /5 |
NS8_SARS2 ORF8 protein | |
7xmn | K |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
5 /5 |
NS8_SARS2 ORF8 protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |