Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
3788641 | 419 | 217 | YP_009724397.2() | |
QUERYSEQ |
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA |
419 | region | name | description |
1-419 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
419 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8fg2 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8fg2 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8fd5 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6yi3 | A | 99.3 | NCAP_SARS2 Nucleoprotein | ||||
7acs | A | 99.3 | NCAP_SARS2 Nucleoprotein | ||||
7act | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7sd4 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8x1h | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
1ssk | A | 92.0 | NCAP_CVHSA Nucleocapsid protein | ||||
7vnu | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vnu | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8x1h | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7cdz | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8j6x | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iv3 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iqj | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iv3 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iqj | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n3c | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vnu | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8x1h | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uw3 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7cdz | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7cdz | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8j6x | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iqj | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8j6x | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7str | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0r | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0r | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uw3 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7cdz | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6m3m | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6m3m | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6m3m | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iqj | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8j6x | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iv3 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8iv3 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xx1 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xx1 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xx1 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7cr5 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6vyo | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6vyo | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6vyo | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7sts | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7wzo | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6vyo | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vnu | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vbd | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uw3 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
8x1h | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xwz | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6m3m | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wkp | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2ofz | A | 92.1 | NCAP_CVHSA Nucleocapsid protein | ||||
6yun | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o35 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6zco | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wkp | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6yun | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzq | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7de1 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzq | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7sue | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7sue | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7sue | L | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wkp | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzq | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzq | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7c22 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | H | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o36 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7r98 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7sue | K | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7c22 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7r98 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xx1 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o36 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2jw8 | A | 95.8 | NCAP_CVHSA Nucleocapsid protein | ||||
2jw8 | B | 95.8 | NCAP_CVHSA Nucleocapsid protein | ||||
7vbd | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzo | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o05 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o05 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o35 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o36 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o35 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vbf | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xwz | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vbd | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7yld | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxx | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ce0 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ce0 | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ce0 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vbf | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ce0 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzo | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | K | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | J | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxx | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxx | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxx | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxz | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxz | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxz | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxz | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxz | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxz | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxx | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uxx | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7c22 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xxk | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xxk | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xxk | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2cjr | D | 95.7 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
2cjr | A | 95.7 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
7sts | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | G | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o05 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o35 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o36 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7o05 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vbe | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7de1 | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7c22 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzo | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wji | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wji | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wji | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wji | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wji | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wji | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wzo | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7r98 | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7ylb | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7yld | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n3d | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2cjr | C | 95.6 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
2cjr | B | 95.6 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
7vbd | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xxk | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7vbe | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7uw3 | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xxk | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xxk | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | I | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | G | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2b | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2b | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | J | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | H | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2cjr | F | 95.5 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
7yld | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2cjr | E | 95.5 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
2cjr | H | 95.5 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
2og3 | A | 92.9 | NCAP_CVHSA Nucleocapsid protein | ||||
2cjr | G | 95.4 | NCAP_CVHSA NUCLEOCAPSID PROTEIN | ||||
7xwx | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6wkp | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7yld | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xwx | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xwx | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xwx | G | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | B | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | L | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | G | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | C | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7n0i | A | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xwx | D | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7xwx | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | K | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | F | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2gib | A | 95.9 | NCAP_CVHSA Nucleocapsid protein | ||||
7xwx | E | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
2gib | B | 95.8 | NCAP_CVHSA Nucleocapsid protein | ||||
7xwx | H | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
7f2e | L | 100.0 | NCAP_SARS2 Nucleoprotein | ||||
6lnn | B | 60.8 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
7dyd | A | 60.3 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
6lz8 | A | 60.8 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
6kl5 | B | 61.7 | A0A0D3MU65_9BETC Nucleoprotein | ||||
7pku | B | 100.0 | A0A6G9KDV1_SARS2 Nucleoprotein | ||||
6kl6 | B | 61.2 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6kl2 | B | 61.2 | A0A0D3MU65_9BETC Nucleoprotein | ||||
7dyd | C | 60.0 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
6kl6 | A | 60.9 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6kl2 | A | 61.4 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6kl5 | A | 60.5 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6lnn | C | 60.5 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
6lz6 | C | 60.5 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
6lz8 | D | 61.6 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
6kl6 | D | 62.2 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6lz8 | B | 61.8 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
7dyd | D | 61.8 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
6lnn | D | 61.3 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
4ud1 | D | 60.7 | T2B9R0_9BETC N PROTEIN | ||||
6kl6 | C | 62.4 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6lz6 | D | 60.9 | A0A2I2MQD0_9BETC Nucleoprotein | ||||
4ud1 | E | 60.9 | T2B9R0_9BETC N PROTEIN | ||||
6kl5 | D | 62.9 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6kl2 | D | 62.5 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6kl2 | C | 62.5 | A0A0D3MU65_9BETC Nucleoprotein | ||||
6kl5 | C | 62.1 | A0A0D3MU65_9BETC Nucleoprotein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
419 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cr5 | B | monoclonal antibody chain H[216 aa] | A | 100.0 /100.0 |
7 /7 |
NCAP_SARS2 Nucleoprotein | |
7cr5 | C | monoclonal antibody chain L[213 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
7n0i | H | Single-domain antibody E2[136 aa] | A | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
7n0i | H | Single-domain antibody E2[136 aa] | B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7n0i | I | Single-domain antibody E2[135 aa] | C | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
7n0i | I | Single-domain antibody E2[135 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7n0i | J | Single-domain antibody E2[130 aa] | E | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
7n0i | J | Single-domain antibody E2[130 aa] | F | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7n0i | K | Single-domain antibody E2[131 aa] | G | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7n0i | K | Single-domain antibody E2[131 aa] | L | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
7n0r | C | Single-domain antibody C2[123 aa] | A | 100.0 /100.0 |
17 /17 |
NCAP_SARS2 Nucleoprotein | |
7n0r | D | Single-domain antibody C2[123 aa] | B | 100.0 /100.0 |
18 /18 |
NCAP_SARS2 Nucleoprotein | |
7n3c | A | S24-202 Fab heavy chain[226 aa] | C | 100.0 /100.0 |
11 /11 |
NCAP_SARS2 Nucleoprotein | |
7n3c | B | S24-202 Fab light chain[214 aa] | C | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7str | A | Fab S24-1063, Light chain[214 aa] | C | 100.0 /100.0 |
7 /7 |
NCAP_SARS2 Nucleoprotein | |
7n3d | A | S24-1564 Fab heavy chain[223 aa] | C | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
7n3d | B | S24-1564 Fab light chain[213 aa] | C | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7pku | A | A0A6M4N019_SARS2 3C-like proteinase[96 aa] | B | 100.0 /100.0 |
18 /18 |
A0A6G9KDV1_SARS2 Nucleoprotein | |
7wzo | B | R1A_SARS2 nsp3[112 aa] | A | 100.0 /100.0 |
11 /11 |
NCAP_SARS2 Nucleoprotein | |
7wzo | C | R1A_SARS2 nsp3[110 aa] | A | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
7r98 | D | Nanobody B6[129 aa] | A | 100.0 /100.0 |
14 /14 |
NCAP_SARS2 Nucleoprotein | |
7r98 | E | Nanobody B6[130 aa] | B | 100.0 /100.0 |
14 /14 |
NCAP_SARS2 Nucleoprotein | |
7r98 | F | Nanobody B6[130 aa] | C | 100.0 /100.0 |
14 /14 |
NCAP_SARS2 Nucleoprotein | |
7str | B | Fab S24-1063, Heavy chain[222 aa] | C | 100.0 /100.0 |
11 /11 |
NCAP_SARS2 Nucleoprotein | |
7sts | E | Fab S24-1379, heavy chain[210 aa] | C | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
7sts | A | Fab S24-1379, heavy chain[204 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7sts | F | Fab S24-1379, light chain[212 aa] | C | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
7sts | B | Fab S24-1379, light chain[212 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7sue | A | S24-188 Fab Light chain[212 aa] | E | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7sue | C | S24-188 Fab Light chain[212 aa] | F | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7sue | B | S24-188 Fab Heavy chain[227 aa] | E | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7sue | D | S24-188 Fab Heavy chain[227 aa] | F | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7sue | G | S24-188 Fab Light chain[109 aa] | K | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7sue | I | S24-188 Fab Light chain[109 aa] | L | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7sue | H | S24-188 Fab Heavy chain[129 aa] | K | 100.0 /100.0 |
7 /7 |
NCAP_SARS2 Nucleoprotein | |
7sue | J | S24-188 Fab Heavy chain[128 aa] | L | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
7ylb | C | NC2[84 aa] | A | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
7ylb | C | NC2[84 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7ylb | F | NC2[84 aa] | D | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
7ylb | F | NC2[84 aa] | E | 100.0 /100.0 |
9 /9 |
NCAP_SARS2 Nucleoprotein | |
7ylb | I | NC2[84 aa] | G | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
7ylb | I | NC2[84 aa] | H | 100.0 /100.0 |
9 /9 |
NCAP_SARS2 Nucleoprotein | |
7ylb | L | NC2[84 aa] | J | 100.0 /100.0 |
14 /14 |
NCAP_SARS2 Nucleoprotein | |
7ylb | L | NC2[84 aa] | K | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
7yld | E | NN2[84 aa] | A | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
7yld | F | NN2[84 aa] | B | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
7yld | G | NN2[83 aa] | D | 100.0 /100.0 |
9 /9 |
NCAP_SARS2 Nucleoprotein | |
7yld | H | NN2[71 aa] | C | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
419 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7acs | B | RNA (5'-R(P*CP*AP*CP*UP*GP*AP*C)-3') | A | 100.0 /99.3 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7xwz | C | RNA (5'-R(*CP*AP*CP*UP*GP*AP*C)-3') | A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7acs | C | RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') | A | 100.0 /99.3 |
11 /11 |
NCAP_SARS2 Nucleoprotein | |
7xwz | D | RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7xwz | F | RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') | B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7act | B | ssRNA | A | 100.0 /100.0 |
28 /28 |
NCAP_SARS2 Nucleoprotein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
419 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6kl6 | E |
DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. |
B | 83.3 /61.2 |
6 /6 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl6 | E |
DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. |
D | 57.1 /62.2 |
7 /7 |
A0A0D3MU65_9BETC Nucleoprotein | |
8iv3 | E |
DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | E |
DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | E |
DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. |
D | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7o35 | E |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7o35 | E |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
D | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7o36 | E |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7o36 | E |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
B | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7o36 | G |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7o36 | G |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
D | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7uxz | G |
GKP
(2R,3R)-2,3-bis{[(2E)-3-(3,4-dihydroxyphenyl)prop-.. |
A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7xxk | H |
5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | I |
5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | H |
5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] |
B | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | I |
5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | S |
5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xxk | S |
5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | R |
GUN
GUANINE[11 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | R |
GUN
GUANINE[11 atoms] |
D | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | FA |
GMP
GUANOSINE[20 atoms] |
E | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | FA |
GMP
GUANOSINE[20 atoms] |
F | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
8j6x | E |
U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
8j6x | E |
U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. |
B | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
8j6x | E |
U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. |
D | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
6kl5 | E |
DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. |
A | 75.0 /60.5 |
4 /4 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl5 | E |
DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. |
C | 50.0 /62.1 |
4 /4 |
A0A0D3MU65_9BETC Nucleoprotein | |
7dyd | E |
EY3
5-propan-2-yloxy-1H-indole[13 atoms] |
D | 83.3 /61.8 |
6 /6 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lz8 | E |
EY9
5-(2-methoxyethoxy)-1H-indole[14 atoms] |
D | 100.0 /61.6 |
3 /3 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lnn | E |
EJC
5-propoxy-1H-indole[13 atoms] |
B | 100.0 /60.8 |
1 /1 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lnn | E |
EJC
5-propoxy-1H-indole[13 atoms] |
D | 100.0 /61.3 |
5 /5 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lz6 | E |
EY6
5-(2-fluoranylethoxy)-1H-indole[13 atoms] |
D | 100.0 /60.9 |
7 /7 |
A0A2I2MQD0_9BETC Nucleoprotein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
419 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6vyo | F |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | I |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | F |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
6vyo | N |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | N |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | O |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
6vyo | I |
CL
CHLORIDE ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | O |
CL
CHLORIDE ION[1 atoms] |
D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
6wji | G |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | H |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | G |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | H |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | I |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | I |
CL
CHLORIDE ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | J |
CL
CHLORIDE ION[1 atoms] |
D | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
6wji | K |
CL
CHLORIDE ION[1 atoms] |
D | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
6wji | L |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | M |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
6wji | N |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | N |
CL
CHLORIDE ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wji | O |
CL
CHLORIDE ION[1 atoms] |
F | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7f2b | E |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7n3d | O |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7n3d | P |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7uxz | L |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | O |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | P |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | Q |
CL
CHLORIDE ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | U |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xxk | V |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | W |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | X |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | Y |
CL
CHLORIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | CA |
CL
CHLORIDE ION[1 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | DA |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | EA |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | IA |
CL
CHLORIDE ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | HA |
CL
CHLORIDE ION[1 atoms] |
F | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | IA |
CL
CHLORIDE ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | H |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | J |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | M |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | M |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | R |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | H |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | R |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6wkp | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6wkp | G |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wkp | G |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6wkp | H |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wkp | H |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6wkp | J |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wkp | E |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wkp | J |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7cr5 | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | E |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | F |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | F |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | I |
ZN
ZINC ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | I |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | J |
ZN
ZINC ION[1 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7n0i | N |
MG
MAGNESIUM ION[1 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7n3c | T |
IOD
IODIDE ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7n3c | U |
IOD
IODIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7n3c | V |
IOD
IODIDE ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7n3c | W |
IOD
IODIDE ION[1 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7n3c | X |
IOD
IODIDE ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7uxz | J |
NA
SODIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | Z |
NA
SODIUM ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | JA |
NA
SODIUM ION[1 atoms] |
F | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | J |
K
POTASSIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | K |
K
POTASSIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | L |
K
POTASSIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | M |
K
POTASSIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | N |
K
POTASSIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | J |
K
POTASSIUM ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | N |
K
POTASSIUM ION[1 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | AA |
K
POTASSIUM ION[1 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | T |
K
POTASSIUM ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | AA |
K
POTASSIUM ION[1 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xxk | BA |
K
POTASSIUM ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | T |
K
POTASSIUM ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | GA |
K
POTASSIUM ION[1 atoms] |
E | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xxk | GA |
K
POTASSIUM ION[1 atoms] |
F | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
4ud1 | N |
NH4
AMMONIUM ION[1 atoms] |
E | 0.0 /60.9 |
2 /2 |
T2B9R0_9BETC N PROTEIN | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
419 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2cjr | B | NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] | A | 98.1 /95.7 |
52 /52 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2cjr | A | NCAP_CVHSA NUCLEOCAPSID PROTEIN[115 aa] | B | 98.0 /95.6 |
50 /50 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2cjr | D | NCAP_CVHSA NUCLEOCAPSID PROTEIN[115 aa] | C | 98.0 /95.6 |
51 /51 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2cjr | C | NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] | D | 98.1 /95.7 |
53 /53 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2cjr | F | NCAP_CVHSA NUCLEOCAPSID PROTEIN[112 aa] | E | 98.0 /95.5 |
51 /51 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2cjr | E | NCAP_CVHSA NUCLEOCAPSID PROTEIN[110 aa] | F | 98.0 /95.5 |
50 /50 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2cjr | H | NCAP_CVHSA NUCLEOCAPSID PROTEIN[110 aa] | G | 98.0 /95.4 |
49 /49 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2cjr | G | NCAP_CVHSA NUCLEOCAPSID PROTEIN[109 aa] | H | 98.0 /95.5 |
49 /49 |
NCAP_CVHSA NUCLEOCAPSID PROTEIN | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /95.9 |
8 /8 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /95.9 |
6 /6 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /95.9 |
8 /8 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | A | 100.0 /95.9 |
6 /6 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | B | NCAP_CVHSA Nucleocapsid protein[96 aa] | A | 97.8 /95.9 |
45 /45 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | B | NCAP_CVHSA Nucleocapsid protein[96 aa] | A | 100.0 /95.9 |
1 /1 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | B | NCAP_CVHSA Nucleocapsid protein[96 aa] | A | 97.8 /95.9 |
45 /45 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | B | NCAP_CVHSA Nucleocapsid protein[96 aa] | A | 100.0 /95.9 |
1 /1 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | B | NCAP_CVHSA Nucleocapsid protein[96 aa] | A | 97.8 /95.9 |
45 /45 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | B | 97.8 /95.8 |
45 /45 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | B | 100.0 /95.8 |
3 /3 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | B | 97.8 /95.8 |
45 /45 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | B | 100.0 /95.8 |
3 /3 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | A | NCAP_CVHSA Nucleocapsid protein[97 aa] | B | 97.8 /95.8 |
45 /45 |
NCAP_CVHSA Nucleocapsid protein | |
2jw8 | B | NCAP_CVHSA Nucleocapsid protein[118 aa] | A | 97.8 /95.8 |
45 /45 |
NCAP_CVHSA Nucleocapsid protein | |
2jw8 | A | NCAP_CVHSA Nucleocapsid protein[118 aa] | B | 97.6 /95.8 |
41 /41 |
NCAP_CVHSA Nucleocapsid protein | |
6wji | B | NCAP_SARS2 Nucleoprotein[108 aa] | A | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
6wji | A | NCAP_SARS2 Nucleoprotein[108 aa] | B | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
6wji | D | NCAP_SARS2 Nucleoprotein[108 aa] | C | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
6wji | C | NCAP_SARS2 Nucleoprotein[108 aa] | D | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
6wji | F | NCAP_SARS2 Nucleoprotein[108 aa] | E | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
6wji | E | NCAP_SARS2 Nucleoprotein[108 aa] | F | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
6wzo | B | NCAP_SARS2 Nucleoprotein[111 aa] | A | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
6wzo | A | NCAP_SARS2 Nucleoprotein[108 aa] | B | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
6wzo | D | NCAP_SARS2 Nucleoprotein[110 aa] | C | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
6wzo | C | NCAP_SARS2 Nucleoprotein[108 aa] | D | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
6wzq | B | NCAP_SARS2 Nucleoprotein[114 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
6wzq | A | NCAP_SARS2 Nucleoprotein[114 aa] | B | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
6wzq | D | NCAP_SARS2 Nucleoprotein[115 aa] | C | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
6wzq | C | NCAP_SARS2 Nucleoprotein[116 aa] | D | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
6yun | B | NCAP_SARS2 Nucleoprotein[135 aa] | A | 100.0 /100.0 |
55 /55 |
NCAP_SARS2 Nucleoprotein | |
6yun | A | NCAP_SARS2 Nucleoprotein[116 aa] | B | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
6zco | A | NCAP_SARS2 Nucleoprotein[118 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
6zco | A | NCAP_SARS2 Nucleoprotein[118 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7c22 | B | NCAP_SARS2 Nucleoprotein[113 aa] | A | 100.0 /100.0 |
51 /51 |
NCAP_SARS2 Nucleoprotein | |
7c22 | A | NCAP_SARS2 Nucleoprotein[109 aa] | B | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7c22 | D | NCAP_SARS2 Nucleoprotein[108 aa] | C | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7c22 | C | NCAP_SARS2 Nucleoprotein[112 aa] | D | 100.0 /100.0 |
55 /55 |
NCAP_SARS2 Nucleoprotein | |
7ce0 | D | NCAP_SARS2 Nucleoprotein[110 aa] | A | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7ce0 | C | NCAP_SARS2 Nucleoprotein[110 aa] | B | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7ce0 | B | NCAP_SARS2 Nucleoprotein[110 aa] | C | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7ce0 | A | NCAP_SARS2 Nucleoprotein[110 aa] | D | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7de1 | B | NCAP_SARS2 Nucleoprotein[115 aa] | A | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7de1 | A | NCAP_SARS2 Nucleoprotein[108 aa] | B | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7f2b | B | NCAP_SARS2 Nucleoprotein[106 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7f2b | A | NCAP_SARS2 Nucleoprotein[106 aa] | B | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7f2e | B | NCAP_SARS2 Nucleoprotein[106 aa] | A | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7f2e | A | NCAP_SARS2 Nucleoprotein[106 aa] | B | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7f2e | D | NCAP_SARS2 Nucleoprotein[107 aa] | C | 100.0 /100.0 |
48 /48 |
NCAP_SARS2 Nucleoprotein | |
7f2e | C | NCAP_SARS2 Nucleoprotein[107 aa] | D | 100.0 /100.0 |
49 /49 |
NCAP_SARS2 Nucleoprotein | |
7f2e | E | NCAP_SARS2 Nucleoprotein[96 aa] | F | 100.0 /100.0 |
43 /43 |
NCAP_SARS2 Nucleoprotein | |
7f2e | H | NCAP_SARS2 Nucleoprotein[106 aa] | G | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7f2e | G | NCAP_SARS2 Nucleoprotein[107 aa] | H | 100.0 /100.0 |
51 /51 |
NCAP_SARS2 Nucleoprotein | |
7f2e | J | NCAP_SARS2 Nucleoprotein[106 aa] | I | 100.0 /100.0 |
51 /51 |
NCAP_SARS2 Nucleoprotein | |
7f2e | I | NCAP_SARS2 Nucleoprotein[107 aa] | J | 100.0 /100.0 |
50 /50 |
NCAP_SARS2 Nucleoprotein | |
7f2e | K | NCAP_SARS2 Nucleoprotein[96 aa] | L | 100.0 /100.0 |
39 /39 |
NCAP_SARS2 Nucleoprotein | |
7n0i | B | NCAP_SARS2 Nucleoprotein[96 aa] | A | 100.0 /100.0 |
43 /43 |
NCAP_SARS2 Nucleoprotein | |
7n0i | A | NCAP_SARS2 Nucleoprotein[96 aa] | B | 100.0 /100.0 |
44 /44 |
NCAP_SARS2 Nucleoprotein | |
7n0i | D | NCAP_SARS2 Nucleoprotein[96 aa] | C | 100.0 /100.0 |
44 /44 |
NCAP_SARS2 Nucleoprotein | |
7n0i | C | NCAP_SARS2 Nucleoprotein[96 aa] | D | 100.0 /100.0 |
44 /44 |
NCAP_SARS2 Nucleoprotein | |
7n0i | F | NCAP_SARS2 Nucleoprotein[96 aa] | E | 100.0 /100.0 |
43 /43 |
NCAP_SARS2 Nucleoprotein | |
7n0i | E | NCAP_SARS2 Nucleoprotein[96 aa] | F | 100.0 /100.0 |
38 /38 |
NCAP_SARS2 Nucleoprotein | |
7n0i | L | NCAP_SARS2 Nucleoprotein[96 aa] | G | 100.0 /100.0 |
42 /42 |
NCAP_SARS2 Nucleoprotein | |
7n0i | G | NCAP_SARS2 Nucleoprotein[96 aa] | L | 100.0 /100.0 |
39 /39 |
NCAP_SARS2 Nucleoprotein | |
7o05 | C | NCAP_SARS2 Nucleoprotein[111 aa] | A | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7o05 | D | NCAP_SARS2 Nucleoprotein[111 aa] | B | 100.0 /100.0 |
50 /50 |
NCAP_SARS2 Nucleoprotein | |
7o05 | A | NCAP_SARS2 Nucleoprotein[109 aa] | C | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7o05 | B | NCAP_SARS2 Nucleoprotein[109 aa] | D | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7o35 | B | NCAP_SARS2 Nucleoprotein[123 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7o35 | A | NCAP_SARS2 Nucleoprotein[111 aa] | B | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7o35 | D | NCAP_SARS2 Nucleoprotein[109 aa] | C | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7o35 | C | NCAP_SARS2 Nucleoprotein[111 aa] | D | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7o36 | B | NCAP_SARS2 Nucleoprotein[109 aa] | A | 100.0 /100.0 |
55 /55 |
NCAP_SARS2 Nucleoprotein | |
7o36 | A | NCAP_SARS2 Nucleoprotein[112 aa] | B | 100.0 /100.0 |
51 /51 |
NCAP_SARS2 Nucleoprotein | |
7o36 | D | NCAP_SARS2 Nucleoprotein[111 aa] | C | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7o36 | C | NCAP_SARS2 Nucleoprotein[113 aa] | D | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7uxx | C | NCAP_SARS2 Nucleoprotein[109 aa] | A | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7uxx | D | NCAP_SARS2 Nucleoprotein[109 aa] | B | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7uxx | A | NCAP_SARS2 Nucleoprotein[109 aa] | C | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7uxx | B | NCAP_SARS2 Nucleoprotein[109 aa] | D | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7uxx | F | NCAP_SARS2 Nucleoprotein[110 aa] | E | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7uxx | E | NCAP_SARS2 Nucleoprotein[109 aa] | F | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7uxz | B | NCAP_SARS2 Nucleoprotein[109 aa] | A | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7uxz | A | NCAP_SARS2 Nucleoprotein[109 aa] | B | 100.0 /100.0 |
55 /55 |
NCAP_SARS2 Nucleoprotein | |
7uxz | D | NCAP_SARS2 Nucleoprotein[109 aa] | C | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7uxz | C | NCAP_SARS2 Nucleoprotein[109 aa] | D | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7uxz | F | NCAP_SARS2 Nucleoprotein[109 aa] | E | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7uxz | E | NCAP_SARS2 Nucleoprotein[109 aa] | F | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7vbe | B | NCAP_SARS2 Nucleoprotein[107 aa] | A | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7vbe | A | NCAP_SARS2 Nucleoprotein[108 aa] | B | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7vbf | B | NCAP_SARS2 Nucleoprotein[110 aa] | A | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7vbf | A | NCAP_SARS2 Nucleoprotein[116 aa] | B | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7xwx | E | NCAP_SARS2 Nucleoprotein[92 aa] | A | 100.0 /100.0 |
43 /43 |
NCAP_SARS2 Nucleoprotein | |
7xwx | F | NCAP_SARS2 Nucleoprotein[96 aa] | B | 100.0 /100.0 |
44 /44 |
NCAP_SARS2 Nucleoprotein | |
7xwx | D | NCAP_SARS2 Nucleoprotein[96 aa] | C | 100.0 /100.0 |
44 /44 |
NCAP_SARS2 Nucleoprotein | |
7xwx | C | NCAP_SARS2 Nucleoprotein[99 aa] | D | 100.0 /100.0 |
45 /45 |
NCAP_SARS2 Nucleoprotein | |
7xwx | A | NCAP_SARS2 Nucleoprotein[99 aa] | E | 100.0 /100.0 |
46 /46 |
NCAP_SARS2 Nucleoprotein | |
7xwx | B | NCAP_SARS2 Nucleoprotein[99 aa] | F | 100.0 /100.0 |
45 /45 |
NCAP_SARS2 Nucleoprotein | |
7xwx | H | NCAP_SARS2 Nucleoprotein[90 aa] | G | 100.0 /100.0 |
43 /43 |
NCAP_SARS2 Nucleoprotein | |
7xwx | G | NCAP_SARS2 Nucleoprotein[99 aa] | H | 100.0 /100.0 |
46 /46 |
NCAP_SARS2 Nucleoprotein | |
7xxk | B | NCAP_SARS2 Nucleoprotein[107 aa] | A | 100.0 /100.0 |
55 /55 |
NCAP_SARS2 Nucleoprotein | |
7xxk | A | NCAP_SARS2 Nucleoprotein[109 aa] | B | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7xxk | D | NCAP_SARS2 Nucleoprotein[109 aa] | C | 100.0 /100.0 |
53 /53 |
NCAP_SARS2 Nucleoprotein | |
7xxk | C | NCAP_SARS2 Nucleoprotein[107 aa] | D | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7xxk | F | NCAP_SARS2 Nucleoprotein[107 aa] | E | 100.0 /100.0 |
54 /54 |
NCAP_SARS2 Nucleoprotein | |
7xxk | E | NCAP_SARS2 Nucleoprotein[109 aa] | F | 100.0 /100.0 |
51 /51 |
NCAP_SARS2 Nucleoprotein | |
7ylb | B | NCAP_SARS2 Nucleoprotein[114 aa] | A | 100.0 /100.0 |
49 /49 |
NCAP_SARS2 Nucleoprotein | |
7ylb | A | NCAP_SARS2 Nucleoprotein[108 aa] | B | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7ylb | E | NCAP_SARS2 Nucleoprotein[111 aa] | D | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7ylb | D | NCAP_SARS2 Nucleoprotein[110 aa] | E | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7ylb | H | NCAP_SARS2 Nucleoprotein[113 aa] | G | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7ylb | G | NCAP_SARS2 Nucleoprotein[109 aa] | H | 100.0 /100.0 |
51 /51 |
NCAP_SARS2 Nucleoprotein | |
7ylb | K | NCAP_SARS2 Nucleoprotein[110 aa] | J | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
7ylb | J | NCAP_SARS2 Nucleoprotein[110 aa] | K | 100.0 /100.0 |
52 /52 |
NCAP_SARS2 Nucleoprotein | |
6vyo | B | NCAP_SARS2 Nucleoprotein[125 aa] | A | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
6vyo | D | NCAP_SARS2 Nucleoprotein[125 aa] | A | 100.0 /100.0 |
9 /9 |
NCAP_SARS2 Nucleoprotein | |
6vyo | A | NCAP_SARS2 Nucleoprotein[124 aa] | B | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
6vyo | C | NCAP_SARS2 Nucleoprotein[125 aa] | B | 100.0 /100.0 |
7 /7 |
NCAP_SARS2 Nucleoprotein | |
6vyo | B | NCAP_SARS2 Nucleoprotein[125 aa] | C | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
6vyo | D | NCAP_SARS2 Nucleoprotein[125 aa] | C | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
6vyo | A | NCAP_SARS2 Nucleoprotein[124 aa] | D | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
6vyo | C | NCAP_SARS2 Nucleoprotein[125 aa] | D | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
6wkp | B | NCAP_SARS2 Nucleoprotein[117 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
6wkp | D | NCAP_SARS2 Nucleoprotein[115 aa] | A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
6wkp | A | NCAP_SARS2 Nucleoprotein[103 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
6wkp | C | NCAP_SARS2 Nucleoprotein[120 aa] | B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
6wkp | B | NCAP_SARS2 Nucleoprotein[117 aa] | C | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
6wkp | D | NCAP_SARS2 Nucleoprotein[115 aa] | C | 100.0 /100.0 |
14 /14 |
NCAP_SARS2 Nucleoprotein | |
6wkp | A | NCAP_SARS2 Nucleoprotein[103 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
6wkp | C | NCAP_SARS2 Nucleoprotein[120 aa] | D | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | B | NCAP_SARS2 Nucleoprotein[125 aa] | A | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | D | NCAP_SARS2 Nucleoprotein[119 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | A | NCAP_SARS2 Nucleoprotein[125 aa] | B | 100.0 /100.0 |
16 /16 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | C | NCAP_SARS2 Nucleoprotein[125 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | B | NCAP_SARS2 Nucleoprotein[125 aa] | C | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | D | NCAP_SARS2 Nucleoprotein[119 aa] | C | 100.0 /100.0 |
12 /12 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | A | NCAP_SARS2 Nucleoprotein[125 aa] | D | 100.0 /100.0 |
9 /9 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | C | NCAP_SARS2 Nucleoprotein[125 aa] | D | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | B | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | C | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | D | NCAP_SARS2 Nucleoprotein[126 aa] | A | 100.0 /100.0 |
11 /11 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | A | NCAP_SARS2 Nucleoprotein[126 aa] | B | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | C | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | D | NCAP_SARS2 Nucleoprotein[126 aa] | B | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | A | NCAP_SARS2 Nucleoprotein[126 aa] | C | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | B | NCAP_SARS2 Nucleoprotein[128 aa] | C | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | A | NCAP_SARS2 Nucleoprotein[126 aa] | D | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8iv3 | B | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8j6x | B | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8j6x | C | NCAP_SARS2 Nucleoprotein[127 aa] | A | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8j6x | D | NCAP_SARS2 Nucleoprotein[127 aa] | A | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8j6x | A | NCAP_SARS2 Nucleoprotein[126 aa] | B | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8j6x | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8j6x | D | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
8j6x | A | NCAP_SARS2 Nucleoprotein[126 aa] | C | 100.0 /100.0 |
7 /7 |
NCAP_SARS2 Nucleoprotein | |
8j6x | B | NCAP_SARS2 Nucleoprotein[128 aa] | C | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8j6x | A | NCAP_SARS2 Nucleoprotein[126 aa] | D | 100.0 /100.0 |
10 /10 |
NCAP_SARS2 Nucleoprotein | |
8j6x | B | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | A | 100.0 /100.0 |
128 /128 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | A | 100.0 /100.0 |
15 /15 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | A | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | B | 100.0 /100.0 |
130 /130 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | B | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | B | 100.0 /100.0 |
8 /8 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | C | 100.0 /100.0 |
13 /13 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | C | 100.0 /100.0 |
127 /127 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | A | NCAP_SARS2 Nucleoprotein[128 aa] | D | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | B | NCAP_SARS2 Nucleoprotein[130 aa] | D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | C | NCAP_SARS2 Nucleoprotein[127 aa] | D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
8x1h | D | NCAP_SARS2 Nucleoprotein[122 aa] | D | 100.0 /100.0 |
122 /122 |
NCAP_SARS2 Nucleoprotein | |
7f2e | F | NCAP_SARS2 Nucleoprotein[97 aa] | E | 100.0 /100.0 |
43 /43 |
NCAP_SARS2 Nucleoprotein | |
7f2e | L | NCAP_SARS2 Nucleoprotein[92 aa] | K | 100.0 /100.0 |
41 /41 |
NCAP_SARS2 Nucleoprotein | |
6kl2 | C | A0A0D3MU65_9BETC Nucleoprotein[104 aa] | A | 57.1 /61.4 |
7 /9 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl2 | D | A0A0D3MU65_9BETC Nucleoprotein[104 aa] | B | 75.0 /61.2 |
8 /10 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl2 | A | A0A0D3MU65_9BETC Nucleoprotein[116 aa] | C | 54.5 /62.5 |
11 /11 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl2 | B | A0A0D3MU65_9BETC Nucleoprotein[118 aa] | D | 53.8 /62.5 |
13 /13 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl5 | C | A0A0D3MU65_9BETC Nucleoprotein[103 aa] | A | 75.0 /60.5 |
4 /4 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl5 | D | A0A0D3MU65_9BETC Nucleoprotein[105 aa] | B | 60.0 /61.7 |
5 /7 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl5 | A | A0A0D3MU65_9BETC Nucleoprotein[114 aa] | C | 66.7 /62.1 |
6 /6 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl5 | B | A0A0D3MU65_9BETC Nucleoprotein[123 aa] | D | 66.7 /62.9 |
9 /9 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl6 | C | A0A0D3MU65_9BETC Nucleoprotein[109 aa] | A | 62.5 /60.9 |
8 /10 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl6 | D | A0A0D3MU65_9BETC Nucleoprotein[111 aa] | B | 66.7 /61.2 |
6 /6 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl6 | A | A0A0D3MU65_9BETC Nucleoprotein[117 aa] | C | 63.6 /62.4 |
11 /11 |
A0A0D3MU65_9BETC Nucleoprotein | |
6kl6 | B | A0A0D3MU65_9BETC Nucleoprotein[116 aa] | D | 50.0 /62.2 |
6 /6 |
A0A0D3MU65_9BETC Nucleoprotein | |
6lnn | D | A0A2I2MQD0_9BETC Nucleoprotein[111 aa] | B | 66.7 /60.8 |
9 /12 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lnn | A | A0A2I2MQD0_9BETC Nucleoprotein[129 aa] | C | 54.5 /60.5 |
11 /11 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lnn | B | A0A2I2MQD0_9BETC Nucleoprotein[128 aa] | D | 57.1 /61.3 |
14 /14 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lz6 | A | A0A2I2MQD0_9BETC Nucleoprotein[130 aa] | C | 66.7 /60.5 |
12 /12 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lz6 | B | A0A2I2MQD0_9BETC Nucleoprotein[129 aa] | D | 63.6 /60.9 |
11 /11 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lz8 | B | A0A2I2MQD0_9BETC Nucleoprotein[110 aa] | A | 62.5 /60.8 |
8 /11 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lz8 | A | A0A2I2MQD0_9BETC Nucleoprotein[128 aa] | B | 50.0 /61.8 |
10 /10 |
A0A2I2MQD0_9BETC Nucleoprotein | |
6lz8 | C | A0A2I2MQD0_9BETC Nucleoprotein[130 aa] | D | 66.7 /61.6 |
12 /12 |
A0A2I2MQD0_9BETC Nucleoprotein | |
7dyd | C | A0A2I2MQD0_9BETC Nucleoprotein[115 aa] | A | 62.5 /60.3 |
8 /11 |
A0A2I2MQD0_9BETC Nucleoprotein | |
7dyd | A | A0A2I2MQD0_9BETC Nucleoprotein[129 aa] | C | 54.5 /60.0 |
11 /11 |
A0A2I2MQD0_9BETC Nucleoprotein | |
7dyd | B | A0A2I2MQD0_9BETC Nucleoprotein[129 aa] | D | 58.3 /61.8 |
12 /12 |
A0A2I2MQD0_9BETC Nucleoprotein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
419 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2gib | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /95.9 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /95.9 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /95.9 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /95.9 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
2gib | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /95.9 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
6wzq | E |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
6wzq | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wzq | G |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6wzq | H |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
6wzq | I |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6wzq | J |
SO4
SULFATE ION[5 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7n0r | F |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7n0r | G |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7ylb | M |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7ylb | N |
SO4
SULFATE ION[5 atoms] |
E | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7ylb | O |
SO4
SULFATE ION[5 atoms] |
H | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7ylb | P |
SO4
SULFATE ION[5 atoms] |
K | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
2ofz | B |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /92.1 |
2 /2 |
NCAP_CVHSA Nucleocapsid protein | |
7n3c | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7n3c | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7n3c | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7n3d | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7n3d | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7n3d | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7n3d | N |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7str | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7str | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7str | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7xwz | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7xwz | H |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
4ud1 | M |
GOL
GLYCEROL[6 atoms] |
D | 0.0 /60.7 |
3 /3 |
T2B9R0_9BETC N PROTEIN | |
6vyo | K |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | P |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
6vyo | S |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | T |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /100.0 |
7 /7 |
NCAP_SARS2 Nucleoprotein | |
7o36 | F |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7o36 | F |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
9 /9 |
NCAP_SARS2 Nucleoprotein | |
7uxx | G |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7uxx | H |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7uxx | G |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7uxx | H |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7uxx | J |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7uxz | I |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7uxz | I |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7uxz | K |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7uxz | N |
GOL
GLYCEROL[6 atoms] |
F | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7xwz | I |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
8x1h | E |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
6vyo | E |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
A | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
6vyo | G |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | G |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
B | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
6vyo | L |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
B | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
6vyo | L |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
C | 100.0 /100.0 |
6 /6 |
NCAP_SARS2 Nucleoprotein | |
6vyo | Q |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6vyo | E |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
6vyo | Q |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
D | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
6wkp | F |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
A | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
6wkp | F |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
B | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
6wkp | I |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
6wkp | I |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
D | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | G |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
A | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | L |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | G |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
B | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | H |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | H |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | K |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | K |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
D | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xx1 | L |
MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] |
D | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7c22 | E |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7c22 | E |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7c22 | G |
ACT
ACETATE ION[4 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7c22 | G |
ACT
ACETATE ION[4 atoms] |
D | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7n0i | M |
ACT
ACETATE ION[4 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7n0i | M |
ACT
ACETATE ION[4 atoms] |
D | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7n0i | O |
ACT
ACETATE ION[4 atoms] |
L | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7uxx | I |
ACT
ACETATE ION[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7uxx | I |
ACT
ACETATE ION[4 atoms] |
D | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7vnu | E |
ACT
ACETATE ION[4 atoms] |
C | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7c22 | F |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7de1 | C |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7de1 | D |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7de1 | E |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7uxz | H |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
A | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7uxz | H |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7uxz | M |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
F | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7f2b | C |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7f2b | D |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7f2b | F |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
7f2b | G |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7f2b | H |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7f2b | I |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7f2e | M |
PO4
PHOSPHATE ION[5 atoms] |
G | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7f2e | N |
PO4
PHOSPHATE ION[5 atoms] |
G | 100.0 /100.0 |
3 /3 |
NCAP_SARS2 Nucleoprotein | |
7f2e | M |
PO4
PHOSPHATE ION[5 atoms] |
H | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7f2e | N |
PO4
PHOSPHATE ION[5 atoms] |
H | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7f2e | O |
PO4
PHOSPHATE ION[5 atoms] |
I | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7f2e | P |
PO4
PHOSPHATE ION[5 atoms] |
I | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7f2e | O |
PO4
PHOSPHATE ION[5 atoms] |
J | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7f2e | P |
PO4
PHOSPHATE ION[5 atoms] |
J | 100.0 /100.0 |
1 /1 |
NCAP_SARS2 Nucleoprotein | |
7n3c | Y |
PO4
PHOSPHATE ION[5 atoms] |
C | 100.0 /100.0 |
4 /4 |
NCAP_SARS2 Nucleoprotein | |
7xwx | I |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xwx | J |
PO4
PHOSPHATE ION[5 atoms] |
B | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xwx | K |
PO4
PHOSPHATE ION[5 atoms] |
C | 100.0 /100.0 |
2 /2 |
NCAP_SARS2 Nucleoprotein | |
7xxk | G |
SCN
THIOCYANATE ION[3 atoms] |
A | 100.0 /100.0 |
5 /5 |
NCAP_SARS2 Nucleoprotein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |