Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
348941 | 198 | 148 | YP_009725304.1() | |
QUERYSEQ |
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
198 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() ![]() |
1-198 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
198 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 97.4 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 97.4 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 nsp8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 nsp8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 97.4 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 97.2 | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1A_SARS2 Replicase polyprotein 1a | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1A_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1A_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1A_SARS2 Replicase polyprotein 1a | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 100.0 | R1A_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1A_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 SARS-CoV-2 nsp8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1A_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 96.5 | R1AB_CVHSA Non-structural protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 96.5 | R1A_CVHSA NSP8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 96.4 | R1A_CVHSA NSP8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 96.3 | R1A_CVHSA NSP8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 44.0 | U6BRU0_9ALPC nsp8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 100.0 | R1AB_SARS2 SARS-CoV-2 nsp8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 SARS-CoV-2 nsp8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 43.3 | U6BRU0_9ALPC nsp8 | |||
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | A0A8A0A7W8_SARS2 ORF1a polyprotein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 43.2 | R1AB_FIPV Non-structural protein 6, nsp6, | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 42.7 | R1AB_FIPV Non-structural protein 6, nsp6, | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 8 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | E | 100.0 /97.4 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | E | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | E | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | F | 100.0 /97.2 |
24 /24 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | G | 100.0 /97.4 |
22 /22 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | G | 100.0 /97.4 |
22 /22 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | G | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | G | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] | H | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | H | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] | H | 100.0 /97.4 |
10 /10 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | H | 100.0 /97.4 |
25 /25 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] | H | 100.0 /97.4 |
25 /25 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1A_CVHSA Non-structural protein 7[79 aa] | B | 100.0 /96.5 |
25 /25 |
R1AB_CVHSA Non-structural protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1A_SARS2 Non-structural protein 7[81 aa] | A | 100.0 /100.0 |
24 /24 |
R1A_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 7[70 aa] | C | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 7[70 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA NSP7[70 aa] | B | 100.0 /96.5 |
5 /5 |
R1A_CVHSA NSP8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_CVHSA NSP7[70 aa] | D | 100.0 /96.3 |
24 /24 |
R1A_CVHSA NSP8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[80 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[74 aa] | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[74 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[62 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1A_SARS2 Replicase polyprotein 1a[71 aa] | B | 100.0 /100.0 |
26 /26 |
R1A_SARS2 Replicase polyprotein 1a |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Replicase polyprotein 1a[71 aa] | D | 100.0 /100.0 |
25 /25 |
R1A_SARS2 Replicase polyprotein 1a |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 nsp7[73 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 nsp7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[67 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[67 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 SARS-CoV-2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 7[68 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 7[68 aa] | D | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[65 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[65 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[68 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[68 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 7[63 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 7[63 aa] | C | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1A_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
26 /26 |
R1A_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[76 aa] | D | 100.0 /100.0 |
22 /22 |
R1A_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1A_SARS2 Non-structural protein 7[76 aa] | F | 100.0 /100.0 |
21 /21 |
R1A_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1A_SARS2 Non-structural protein 7[75 aa] | H | 100.0 /100.0 |
23 /23 |
R1A_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Non-structural protein 7[69 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Non-structural protein 7[69 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | D | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[69 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[69 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Non-structural protein 7[69 aa] | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Non-structural protein 7[69 aa] | F | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | R1AB_SARS2 Non-structural protein 7[72 aa] | J | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | R1AB_SARS2 Non-structural protein 7[72 aa] | L | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[79 aa] | B | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[81 aa] | B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 7[79 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[81 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[63 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 SARS-CoV-2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] | G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 SARS-CoV-2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[62 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[75 aa] | D | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | R1AB_SARS2 Non-structural protein 7[75 aa] | G | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | R1AB_SARS2 Non-structural protein 7[75 aa] | L | 100.0 /100.0 |
22 /22 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | F | 100.0 /100.0 |
23 /23 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | F | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
21 /21 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Replicase polyprotein 1a[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Replicase polyprotein 1a[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[78 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[76 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[76 aa] | D | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[56 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Non-structural protein 7[56 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[72 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[73 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | C | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | D | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA NSP12[793 aa] | B | 100.0 /96.5 |
45 /45 |
R1A_CVHSA NSP8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA NSP12[793 aa] | D | 100.0 /96.3 |
2 /2 |
R1A_CVHSA NSP8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[801 aa] | B | 100.0 /100.0 |
36 /36 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[801 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 nsp12[853 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 nsp12[853 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 12[911 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 12[911 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[814 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[814 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12[814 .. | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 SARS-CoV-2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[915 aa] | C | 100.0 /100.0 |
48 /48 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[915 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[836 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[836 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[834 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[811 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[914 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[914 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[826 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[826 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
36 /36 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
31 /31 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 RNA-directed RNA polymerase[898 aa] | A | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 RNA-directed RNA polymerase[898 aa] | C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 RNA-directed RNA polymerase[908 aa] | D | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 RNA-directed RNA polymerase[908 aa] | F | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymeras[908 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymeras[908 aa] | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[906 aa] | B | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[906 aa] | F | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 RNA-directed RNA polymerase[925 aa] | D | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 RNA-directed RNA polymerase[925 aa] | F | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
32 /32 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | J | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | L | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[832 aa] | B | 100.0 /100.0 |
36 /36 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. | B | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 SARS-CoV-2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. | G | 100.0 /100.0 |
25 /25 |
R1AB_SARS2 SARS-CoV-2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Replicase polyprotein 1ab[814 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Replicase polyprotein 1ab[814 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
41 /41 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
40 /40 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | G | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | L | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[860 aa] | B | 100.0 /100.0 |
35 /35 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | B | 100.0 /100.0 |
44 /44 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[927 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | F | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
42 /42 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | F | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | B | 100.0 /100.0 |
46 /46 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Replicase polyprotein 1ab[928 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Replicase polyprotein 1ab[928 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
47 /47 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | B | 100.0 /100.0 |
38 /38 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
34 /34 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[859 aa] | B | 100.0 /100.0 |
39 /39 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | B | 100.0 /100.0 |
43 /43 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | B | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | D | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] | B | 100.0 /100.0 |
37 /37 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[596 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | R1AB_SARS2 Helicase[596 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | R1AB_SARS2 Helicase[596 aa] | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[588 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Q | R1AB_SARS2 Helicase[596 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[588 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M | R1AB_SARS2 Helicase[588 aa] | J | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
R | R1AB_SARS2 Helicase[596 aa] | J | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | R1AB_SARS2 Helicase[587 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
K | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[590 aa] | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[590 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N | R1AB_SARS2 Helicase[590 aa] | G | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M | R1AB_SARS2 Helicase[590 aa] | L | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase nsp13[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase nsp13[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase nsp13[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[586 aa] | D | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Helicase[586 aa] | B | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Helicase[585 aa] | D | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
P | R1AB_SARS2 Proofreading exoribonuclease[524 aa] | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 7[37 aa] | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA NSP12[715 aa] | B | 100.0 /96.4 |
40 /40 |
R1A_CVHSA NSP8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | U6BRU0_9ALPC nsp12[921 aa] | B | 45.0 /44.0 |
40 /40 |
U6BRU0_9ALPC nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | U6BRU0_9ALPC nsp12[921 aa] | D | 45.5 /43.3 |
11 /11 |
U6BRU0_9ALPC nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | U6BRU0_9ALPC nsp7[70 aa] | B | 33.3 /44.0 |
3 /3 |
U6BRU0_9ALPC nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | U6BRU0_9ALPC nsp7[70 aa] | D | 60.0 /43.3 |
20 /21 |
U6BRU0_9ALPC nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_FIPV Non-structural protein 7, nsp7[82 aa] | A | 33.3 /42.7 |
12 /12 |
R1AB_FIPV Non-structural protein 6, nsp6, |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_FIPV Non-structural protein 7, nsp7[82 aa] | A | 61.3 /42.7 |
31 /31 |
R1AB_FIPV Non-structural protein 6, nsp6, |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_FIPV Non-structural protein 7, nsp7[81 aa] | D | 30.0 /43.2 |
10 /10 |
R1AB_FIPV Non-structural protein 6, nsp6, |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_FIPV Non-structural protein 7, nsp7[78 aa] | D | 55.2 /43.2 |
29 /29 |
R1AB_FIPV Non-structural protein 6, nsp6, |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Product RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Product RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Product RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Product RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Product RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
O | Product RNA | G | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
O | Product RNA | L | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA product | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | RNA product | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA product | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | RNA product | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | RNA product | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (29-MER) | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (25-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (25-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | Primer RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Primer RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
S | primer RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
S | primer RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
U | primer RNA | J | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
U | primer RNA | L | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (25-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (25-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | primer | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
I | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
H | RNA (25-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | RNA (25-MER) | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | primer | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (25-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (25-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (26-MER) | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (26-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Primer | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Primer | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | F | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (57-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (57-MER) | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (33-MER) | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (33-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T | Template RNA | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
V | Template RNA | J | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
H | template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (37-MER) | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (37-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | RNA (37-MER) | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | RNA (37-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (37-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (37-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | RNA (43-MER) | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | RNA (43-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | RNA (43-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | RNA (43-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (36-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (36-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Template RNA | D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | Template RNA | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P | Template RNA | G | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P | Template RNA | L | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Product RNA (35-MER) | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Template RNA (55-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Template RNA (55-MER) | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
D | Product RNA (35-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Product RNA (35-MER) | F | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Template RNA (55-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Template RNA (55-MER) | F | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Product RNA (35-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | D | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template RNA (55-MER) | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
I | RNA (26-MER) | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
I | RNA (26-MER) | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | template | B | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | template | D | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (27-MER) | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (27-MER) | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | template | D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | Primer RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | Template RNA | D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (33-MER) | B | 50.0 /44.0 |
2 /2 |
U6BRU0_9ALPC nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNA (33-MER) | D | 66.7 /43.3 |
3 /3 |
U6BRU0_9ALPC nsp8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | RNA (55-MER) | D | 100.0 /43.3 |
2 /2 |
U6BRU0_9ALPC nsp8 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
1N7
|
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
U |
1N7
|
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
1N7
|
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
U |
1N7
|
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
O |
1N7
|
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
U |
1N7
|
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
T |
1N7
|
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
AA |
1N7
|
D | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
RA |
1N7
|
L | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 8 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | E | 100.0 /97.4 |
19 /19 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | E | 100.0 /97.4 |
19 /19 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
8 /8 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | E | 100.0 /97.4 |
5 /5 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | F | 100.0 /97.2 |
18 /18 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | F | 100.0 /97.2 |
18 /18 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | F | 100.0 /97.2 |
6 /6 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | G | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | G | 100.0 /97.4 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | G | 100.0 /97.4 |
9 /9 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] | H | 100.0 /97.4 |
7 /7 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | H | 100.0 /97.4 |
11 /11 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] | H | 100.0 /97.4 |
11 /11 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
D | U6BRU0_9ALPC nsp8[184 aa] | B | 0.0 /44.0 |
1 /1 |
U6BRU0_9ALPC nsp8 |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | U6BRU0_9ALPC nsp8[184 aa] | D | 0.0 /43.3 |
1 /1 |
U6BRU0_9ALPC nsp8 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
198 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
EDO
|
B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
EDO
|
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
EDO
|
D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
EDO
|
D | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
ACY
|
B | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
ACY
|
D | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 8 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N |
SO4
|
H | 75.0 /97.4 |
4 /4 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N |
SO4
|
H | 75.0 /97.4 |
4 /4 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
GOL
|
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
GOL
|
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
GOL
|
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
GOL
|
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
J |
GOL
|
E | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
J |
GOL
|
E | 100.0 /97.4 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
GOL
|
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
K |
GOL
|
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
K |
GOL
|
E | 100.0 /97.4 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
GOL
|
E | 100.0 /97.4 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
L |
GOL
|
F | 100.0 /97.2 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
L |
GOL
|
F | 100.0 /97.2 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
L |
GOL
|
F | 100.0 /97.2 |
2 /2 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
L |
GOL
|
F | 100.0 /97.2 |
1 /1 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
M |
GOL
|
F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
M |
GOL
|
F | 100.0 /97.2 |
3 /3 |
R1AB_CVHSA Replicase polyprotein 1ab, heavy chain |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |