Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[100 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2931865 365 14 P04439(HLAA_HUMAN) RecName: Full=HLA class I histocompatibility antigen, A alpha chain;AltName: Full=Human leukocyte antigen A; Short=HLA-A;Flags: Precursor;
QUERYSEQ 
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL
NEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P04439(HLAA_HUMAN)]

365
region name description
1-24 SIGNAL
25-365 CHAIN /note="HLA class I histocompatibility antigen, A alpha chain" /id="PRO_0000018815"
25-308 TOPO_DOM /note="Extracellular"
309-332 TRANSMEM /note="Helical"
333-365 TOPO_DOM /note="Cytoplasmic"
209-295 DOMAIN /note="Ig-like C1-type"
3-11 REGION /note="VL9 epitope"
25-114 REGION /note="Alpha-1"
115-206 REGION /note="Alpha-2"
207-298 REGION /note="Alpha-3"
299-308 REGION /note="Connecting peptide"
339-365 REGION /note="Disordered"
341-359 COMPBIAS /note="Polar residues"
31-31 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
97-97 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
108-108 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
140-140 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="2" /ligand_note="self-peptide antigen"
167-167 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
170-170 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
183-183 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
183-183 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="2" /ligand_note="self-peptide antigen"
195-195 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
1-365 DISORDER predicted by DISOPRED

MONOMER
365
pdb_id a1 identity[%]2 description
8dvg A 100.0 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha chain
7uc5 A 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain
7uc5 D 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain
7mle A 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain
7stf D 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain
6eny D 100.0 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha chain
7qpd D 100.0 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha chain
7l1d A 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain
2xpg A 100.0 1A03_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA CHAIN
7l1c A 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain
7l1b A 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain
3rl1 A 100.0 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha chain
3rl2 A 100.0 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha chain
7rrg A 100.0 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2xpg B B2MG_HUMAN BETA-2-MICROGLOBULIN[98 aa] A 100.0
/100.0		 29
/29		 1A03_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA ..
3rl1 B B2MG_HUMAN Beta-2-microglobulin[100 aa] A 100.0
/100.0		 30
/30		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
3rl2 B B2MG_HUMAN Beta-2-microglobulin[99 aa] A 100.0
/100.0		 30
/30		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6eny A B2MG_HUMAN Beta-2-microglobulin[99 aa] D 100.0
/100.0		 3
/3		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7l1b B B2MG_HUMAN Beta-2-microglobulin[99 aa] A 100.0
/100.0		 30
/30		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c B B2MG_HUMAN Beta-2-microglobulin[99 aa] A 100.0
/100.0		 32
/32		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1d B B2MG_HUMAN Beta-2-microglobulin[99 aa] A 100.0
/100.0		 29
/29		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7mle B B2MG_HUMAN Beta-2-microglobulin[100 aa] A 100.0
/100.0		 35
/35		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7qpd A B2MG_HUMAN Beta-2-microglobulin[99 aa] D 100.0
/100.0		 30
/30		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7rrg B B2MG_HUMAN Beta-2-microglobulin[100 aa] A 100.0
/100.0		 32
/32		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7stf E B2MG_HUMAN Beta-2-microglobulin[101 aa] D 100.0
/100.0		 33
/33		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 B B2MG_HUMAN Beta-2-microglobulin[99 aa] A 100.0
/100.0		 32
/32		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 E B2MG_HUMAN Beta-2-microglobulin[99 aa] D 100.0
/100.0		 32
/32		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
8dvg B B2MG_HUMAN Beta-2-microglobulin[101 aa] A 100.0
/100.0		 34
/34		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
2xpg C MYPR_HUMAN MYELIN PROTEOLIPID PROTEIN[9 aa] A 100.0
/100.0		 26
/26		 1A03_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA ..
3rl1 C Q9YV12_9HIV1 RT313 peptide[9 aa] A 100.0
/100.0		 25
/25		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
3rl2 C Q9YYU8_9HIV1 Nef73 peptide from Protein Nef[10 aa] A 100.0
/100.0		 24
/24		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6eny B TPSN_HUMAN Tapasin[364 aa] D 100.0
/100.0		 11
/11		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6eny E CALR_HUMAN Calreticulin[365 aa] D 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7qpd E CALR_HUMAN Calreticulin[364 aa] D 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7l1b C PK3CA_HUMAN wild-type PIK3CA peptide[9 aa] A 100.0
/100.0		 24
/24		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c C PK3CA_HUMAN mutant PIK3CA peptide[9 aa] A 100.0
/100.0		 28
/28		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1d C PK3CA_HUMAN Mutant PIK3CA peptide[9 aa] A 100.0
/100.0		 29
/29		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg E PK3CA_HUMAN Mutant PIK3CA peptide[9 aa] A 100.0
/100.0		 29
/29		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1d D T cell receptor, alpha chain[187 aa] A 100.0
/100.0		 6
/6		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1d E T cell receptor, beta chain[247 aa] A 100.0
/100.0		 12
/12		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7mle C NCAP_INBAC Nucleoprotein peptide[9 aa] A 100.0
/100.0		 25
/25		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7qpd B TPSN_HUMAN Tapasin[348 aa] D 100.0
/100.0		 26
/26		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7qpd C PDIA3_HUMAN Protein disulfide-isomerase A3[459 aa] D 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7rrg C T cell receptor, alpha chain[185 aa] A 100.0
/100.0		 10
/10		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg D T cell receptor, beta chain[237 aa] A 100.0
/100.0		 6
/6		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7stf A IgG, Fab Heavy Chain V2[216 aa] D 100.0
/100.0		 16
/16		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7stf B KRAS G12V (7-16)[10 aa] D 100.0
/100.0		 19
/19		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7stf C IgG, Fab Light Chain V2[214 aa] D 100.0
/100.0		 8
/8		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 C NCAP_I46A1 Nucleoprotein peptide[9 aa] A 100.0
/100.0		 30
/30		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 F NCAP_I46A1 Nucleoprotein peptide[9 aa] D 100.0
/100.0		 31
/31		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
8dvg C VAL-VAL-VAL-GLY-ALA-GLY-GLY-VAL-GLY-LYS[10 aa] A 100.0
/100.0		 23
/23		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6eny F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0		 4
/4		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7qpd G alpha-D-glucopyranose-(1-3)-alpha-D-mannopyranose-.. D 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7l1b D GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 1
/1		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1b E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c D GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c E GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c I GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 2
/2		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c J GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg F GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg G GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg H GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 3
/3		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg I GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg J GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg M GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 1
/1		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7rrg R GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 1
/1		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c F FMT
FORMIC ACID[3 atoms] 		A 100.0
/100.0		 4
/4		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c G FMT
FORMIC ACID[3 atoms] 		A 100.0
/100.0		 3
/3		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1d F ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 1
/1		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7mle D SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7mle E SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7mle F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 G SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 H SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 I SO4
SULFATE ION[5 atoms] 		D 100.0
/100.0		 5
/5		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 J SO4
SULFATE ION[5 atoms] 		D 100.0
/100.0		 1
/1		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5 K SO4
SULFATE ION[5 atoms] 		D 100.0
/100.0		 4
/4		 HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
8dvg D SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg E SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg G SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg H SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg I SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg J SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg N SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg Q SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8dvg K PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 1
/1		 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.