Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
27558 | 918 | 26 | P40189(IL6RB_HUMAN) | RecName: Full=Interleukin-6 receptor subunit beta ; Short=IL-6 receptor subunit beta; Short=IL-6R subunit beta; Short=IL-6R-beta; Short=IL-6RB;AltName: Full=CDw130;AltName: Full=Interleukin-6 signal transducer;AltName: Full=Membrane glycoprotein 130; Short=gp130 ;AltName: Full=Oncostatin-M receptor subunit alpha;AltName: CD_antigen=CD130;Flags: Precursor; |
QUERYSEQ |
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGR ETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESV KKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESS QNTSSTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG MPKSYLPQTVRQGGYMPQ |
918 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
1-22 | SIGNAL | |
![]() ![]() |
23-918 | CHAIN | /note="Interleukin-6 receptor subunit beta" /id="PRO_0000010899" |
![]() ![]() ![]() |
23-619 | TOPO_DOM | /note="Extracellular" |
![]() ![]() ![]() |
620-641 | TRANSMEM | /note="Helical" |
![]() ![]() |
642-918 | TOPO_DOM | /note="Cytoplasmic" |
![]() ![]() ![]() |
26-120 | DOMAIN | /note="Ig-like C2-type" |
![]() ![]() ![]() |
125-216 | DOMAIN | /note="Fibronectin type-III 1" |
![]() ![]() ![]() |
224-324 | DOMAIN | /note="Fibronectin type-III 2" |
![]() ![]() ![]() |
329-424 | DOMAIN | /note="Fibronectin type-III 3" |
![]() ![]() ![]() |
426-517 | DOMAIN | /note="Fibronectin type-III 4" |
![]() ![]() ![]() |
518-613 | DOMAIN | /note="Fibronectin type-III 5" |
![]() ![]() ![]() |
660-681 | REGION | /note="Disordered" |
![]() ![]() ![]() |
722-758 | REGION | /note="Disordered" |
![]() ![]() ![]() |
724-758 | COMPBIAS | /note="Polar residues" |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
1-918 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
918 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | IL6RB_HUMAN Interleukin-6 receptor subunit beta | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
918 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Q98823_HHV8 VIRAL IL-6[167 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Q98823_HHV8 VIRAL IL-6[167 aa] | A | 100.0 /100.0 |
18 /18 |
IL6RB_HUMAN INTERLEUKIN-6 RECEPTOR BETA CHAIN |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL6_HUMAN Interleukin-6[163 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor beta chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL6_HUMAN Interleukin-6[163 aa] | A | 100.0 /100.0 |
16 /16 |
IL6RB_HUMAN Interleukin-6 receptor beta chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor beta chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | IL6RA_HUMAN Interleukin-6 receptor alpha chain[201 aa] | A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor beta chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | LIF_HUMAN Leukemia inhibitory factor[169 aa] | A | 100.0 /100.0 |
13 /13 |
IL6RB_HUMAN Interleukin-6 receptor beta chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | LIF_HUMAN Leukemia inhibitory factor[169 aa] | B | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | IL27B_HUMAN Interleukin-27 subunit beta[200 aa] | B | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | IL27A_HUMAN Interleukin-27 subunit alpha[191 aa] | B | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | CNTF_HUMAN Ciliary neurotrophic factor[174 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha.. | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | CLCF1_HUMAN Cardiotrophin-like cytokine factor 1[178 aa] | D | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. | C | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | IL6RA_HUMAN Soluble interleukin-6 receptor subunit alpha[296 a.. | C | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL11_HUMAN Interleukin-11[165 aa] | A | 100.0 /100.0 |
10 /10 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | IL11_HUMAN Interleukin-11[165 aa] | A | 100.0 /100.0 |
13 /13 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] | A | 100.0 /100.0 |
11 /11 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[200 aa] | A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] | A | 100.0 /100.0 |
12 /12 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | I11RA_HUMAN Interleukin-11 receptor subunit alpha[294 aa] | A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
918 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
K |
NAG
|
B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
NAG
|
B | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
NAG
|
B | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
NAG
|
B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
M |
NAG
|
B | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
T |
NAG
|
C | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
Y |
NAG
|
C | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
NAG
|
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
918 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
E |
IOD
|
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor beta chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
O |
CL
|
A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
Q |
CL
|
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
CL
|
A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
CL
|
B | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
CL
|
B | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
918 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
6 /6 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
K | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. | A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | beta-D-mannopyranose-(1-4)-beta-D-mannopyranose-(1.. | A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
G | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | B | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
H | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | B | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. | B | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
918 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
SO4
|
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
J |
SO4
|
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
K |
SO4
|
A | 100.0 /100.0 |
1 /1 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
EDO
|
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
EDO
|
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
EDO
|
A | 87.5 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
EDO
|
A | 100.0 /100.0 |
8 /8 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
A | 100.0 /100.0 |
6 /6 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
EDO
|
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
H |
EDO
|
A | 75.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
EDO
|
A | 100.0 /100.0 |
7 /7 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
EDO
|
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
EDO
|
A | 100.0 /100.0 |
4 /4 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
N |
EDO
|
A | 100.0 /100.0 |
3 /3 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P |
EDO
|
A | 83.3 /100.0 |
6 /6 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
R |
EDO
|
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
S |
EDO
|
A | 100.0 /100.0 |
5 /5 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
![]() ![]() ![]() ![]() ![]() |
![]() |
U |
EDO
|
A | 100.0 /100.0 |
2 /2 |
IL6RB_HUMAN Interleukin-6 receptor subunit beta |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |