Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[80 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2727836 179 7 Q13241(KLRD1_HUMAN) RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ;
QUERYSEQ
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK
NCIAYNPNGNALDESCEDKNRYICKQQLI
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q13241(KLRD1_HUMAN)]

179
region name description
1-179 CHAIN /note="Natural killer cells antigen CD94" /id="PRO_0000046587"
1-10 TOPO_DOM /note="Cytoplasmic"
11-31 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
32-179 TOPO_DOM /note="Extracellular"
68-175 DOMAIN /note="C-type lectin"
1-34 DISORDER predicted by DISOPRED

MONOMER
179
pdb_id a1 identity[%]2 description
3cdg G 100.0 KLRD1_HUMAN Natural killer cells antigen CD94
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
179 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3bdw[6] B NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein[11.. A 100.0
/100.0
17
/17
KLRD1_HUMAN Natural killer cells antigen CD94
3cdg[4] A HLAE_HUMAN HLA class I histocompatibility antigen, alpha chai.. C 100.0
/100.0
13
/13
KLRD1_HUMAN Natural killer cells antigen CD94
3cdg[4] I HLAG_HUMAN leader peptide of HLA class I histocompatibility a.. C 100.0
/100.0
4
/4
KLRD1_HUMAN Natural killer cells antigen CD94
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.