Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2691701 | 207 | 27 | P51149(RAB7A_HUMAN) | RecName: Full=Ras-related protein Rab-7a ; EC=3.6.5.2 ; |
QUERYSEQ |
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIP YFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC |
207 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
2-207 | CHAIN | /note="Ras-related protein Rab-7a" /id="PRO_0000121121" |
![]() ![]() ![]() |
15-22 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" |
![]() ![]() ![]() |
34-40 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" |
![]() ![]() ![]() |
63-67 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" |
![]() ![]() ![]() |
125-128 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" |
![]() ![]() ![]() |
156-157 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" |
![]() ![]() ![]() |
205-205 | LIPID | /note="S-geranylgeranyl cysteine" |
![]() ![]() |
207-207 | LIPID | /note="S-geranylgeranyl cysteine" |
![]() ![]() ![]() |
1-207 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
207 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | RAB7_RAT Ras-related protein Rab-7 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
207 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | RAE1_RAT Rab proteins geranylgeranyltransferase component A.. | B | 100.0 /100.0 |
24 /24 |
RAB7_RAT Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | RAE1_RAT Rab proteins geranylgeranyltransferase component A.. | B | 100.0 /100.0 |
19 /19 |
RAB7_RAT Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | RILP_HUMAN Rab interacting lysosomal protein[65 aa] | A | 100.0 /99.5 |
13 /13 |
RAB7_HUMAN Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | RILP_HUMAN Rab interacting lysosomal protein[65 aa] | A | 100.0 /99.5 |
17 /17 |
RAB7_HUMAN Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich .. | A | 100.0 /99.4 |
18 /18 |
RAB7A_HUMAN Ras-related protein Rab-7a |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | PDZD8_HUMAN PDZ domain-containing protein 8[106 aa] | A | 100.0 /99.4 |
26 /26 |
RAB7A_HUMAN Ras-related protein Rab-7a |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | OSBL1_HUMAN Oxysterol-binding protein-related protein 1[135 aa.. | A | 100.0 /99.4 |
12 /12 |
RAB7A_HUMAN Ras-related protein Rab-7a |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | OSBL1_MOUSE Oxysterol-binding protein-related protein 1[137 aa.. | B | 88.9 /99.4 |
9 /9 |
RAB7A_MOUSE Ras-related protein Rab-7a |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | OSBL1_MOUSE Oxysterol-binding protein-related protein 1[136 aa.. | C | 100.0 /99.4 |
7 /7 |
RAB7A_MOUSE Ras-related protein Rab-7a |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
207 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
GDP
|
B | 100.0 /100.0 |
17 /17 |
RAB7_RAT Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
GNP
|
A | 100.0 /100.0 |
22 /22 |
RAB7_RAT Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
GTP
|
A | 100.0 /99.4 |
23 /23 |
RAB7_HUMAN Ras-related protein Rab-7 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
207 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
J |
K
|
B | 100.0 /100.0 |
1 /1 |
RAB7_RAT Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
MG
|
A | 100.0 /99.4 |
2 /2 |
RAB7_HUMAN Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
MG
|
A | 100.0 /99.4 |
2 /2 |
RAB7A_HUMAN Ras-related protein Rab-7a |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
MG
|
A | 100.0 /99.4 |
5 /5 |
RAB7A_HUMAN Ras-related protein Rab-7a |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
207 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
PG4
|
B | 100.0 /100.0 |
4 /4 |
RAB7_RAT Ras-related protein Rab-7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
P33
|
B | 100.0 /100.0 |
5 /5 |
RAB7_RAT Ras-related protein Rab-7 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |