Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2676554 | 163 | 96 | Q96PD4(IL17F_HUMAN) | RecName: Full=Interleukin-17F; Short=IL-17F;AltName: Full=Cytokine ML-1;Flags: Precursor; |
QUERYSEQ |
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV GCTCVTPVIHHVQ |
163 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
1-30 | SIGNAL | |
![]() ![]() |
31-163 | CHAIN | /note="Interleukin-17F" /id="PRO_0000015432" |
![]() ![]() ![]() ![]() ![]() |
1-163 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
163 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | IL17F_HUMAN Interleukin-17F | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
163 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | IL17_HUMAN Interleukin-17A[109 aa] | B | 100.0 /100.0 |
58 /58 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | Fab MCAF5352A heavy chain[223 aa] | A | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Fab MCAF5352A heavy chain[226 aa] | A | 100.0 /100.0 |
7 /7 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Immunoblobulin heavy chain[219 aa] | C | 100.0 /100.0 |
11 /11 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Immunoblobulin light chain[213 aa] | C | 100.0 /100.0 |
11 /11 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Immunoblobulin light chain[213 aa] | C | 100.0 /100.0 |
6 /6 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | scFv CAT2200 LH[228 aa] | A | 57.1 /61.1 |
7 /7 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | Antibody Fragment Light Chain[210 aa] | E | 100.0 /64.6 |
1 /4 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Antibody Fragment Light Chain[211 aa] | E | 55.6 /64.6 |
9 /15 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
C | Antibody Fragment Heavy Chain[216 aa] | E | 0.0 /64.6 |
1 /4 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | FAB FRAGMENT[216 aa] | A | 40.0 /64.2 |
5 /6 |
IL17_HUMAN INTERLEUKIN-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | FAB FRAGMENT[221 aa] | A | 66.7 /64.2 |
6 /6 |
IL17_HUMAN INTERLEUKIN-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | CAT-2000 FAB heavy chain[220 aa] | A | 70.0 /60.0 |
10 /10 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | CAT-2000 FAB heavy chain[220 aa] | A | 40.0 /60.0 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | CAT-2000 FAB heavy chain[220 aa] | A | 75.0 /64.4 |
8 /8 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | CAT-2000 FAB heavy chain[220 aa] | A | 40.0 /64.4 |
5 /7 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | FAB FRAGMENT[215 aa] | A | 40.0 /64.2 |
5 /5 |
IL17_HUMAN INTERLEUKIN-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | CAT-2000 FAB light chain[213 aa] | A | 40.0 /60.0 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | CAT-2000 FAB light chain[213 aa] | A | 40.0 /64.4 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | IL-17A peptide inhibitor[14 aa] | A | 66.7 /60.0 |
6 /6 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | IL-17A peptide inhibitor[14 aa] | A | 75.0 /60.0 |
8 /8 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | IL-17A peptide inhibitor[14 aa] | A | 66.7 /61.6 |
6 /6 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | IL-17A peptide inhibitor[14 aa] | A | 77.8 /61.6 |
9 /9 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | synthetic IL-17A peptide inhibitor[14 aa] | A | 71.4 /64.4 |
7 /15 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | synthetic IL-17A peptide inhibitor[14 aa] | B | 60.0 /64.3 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Fab Heavy chain[230 aa] | C | 60.0 /61.4 |
10 /10 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Fab Heavy chain[230 aa] | C | 33.3 /61.4 |
3 /4 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | Peptide inhibitor[15 aa] | A | 33.3 /63.2 |
9 /10 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | Peptide inhibitor[15 aa] | A | 80.0 /63.2 |
5 /9 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Fab6785 light chain[209 aa] | E | 47.4 /56.2 |
19 /19 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | Fab6785 light chain[209 aa] | F | 100.0 /62.5 |
1 /1 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Fab6785 heavy chain[211 aa] | E | 25.0 /56.2 |
8 /8 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | spFv CAT2200 LH[244 aa] | C | 66.7 /60.7 |
9 /9 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Heavy chain of HB0017 Fab[212 aa] | E | 75.0 /63.1 |
8 /10 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Light chain of HB0017 Fab[216 aa] | E | 40.0 /63.1 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | Fab MCAF5352A light chain[212 aa] | A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Fab MCAF5352A light chain[216 aa] | A | 100.0 /100.0 |
7 /7 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Fab Light chain[213 aa] | C | 0.0 /61.4 |
2 /4 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | Fab Light chain[213 aa] | C | 50.0 /61.4 |
4 /4 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 11.003 Fab light-chain[213 aa] | G | 77.8 /59.2 |
9 /9 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L | 11.003 Fab light-chain[213 aa] | G | 50.0 /59.2 |
2 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 11.003 Fab heavy-chain[220 aa] | G | 46.2 /59.2 |
13 /13 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
D | 11.003 Fab heavy-chain[220 aa] | I | 50.0 /56.6 |
2 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | anti-IL-17A-76[125 aa] | B | 55.6 /60.4 |
18 /18 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | anti-IL-17A-76[125 aa] | B | 50.0 /60.4 |
2 /3 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL17F_HUMAN Interleukin-17F[120 aa] | A | 65.2 /58.4 |
46 /54 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | I17RA_HUMAN Interleukin-17 receptor A[237 aa] | D | 75.0 /64.4 |
16 /19 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | I17RA_HUMAN Interleukin-17 receptor A[237 aa] | E | 50.0 /56.8 |
24 /24 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | B | 100.0 /100.0 |
25 /25 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | I17RA_HUMAN Interleukin-17 receptor A[272 aa] | A | 78.9 /63.2 |
19 /20 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | I17RA_HUMAN Interleukin-17 receptor A[272 aa] | B | 47.8 /54.8 |
23 /23 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
21 /21 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C[403 aa] | A | 46.7 /62.2 |
15 /19 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C[403 aa] | B | 71.4 /55.7 |
7 /9 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C[422 aa] | A | 55.0 /57.3 |
20 /20 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C[422 aa] | B | 71.4 /55.1 |
14 /15 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | I17RB_HUMAN Interleukin-17 receptor B[247 aa] | A | 43.8 /32.6 |
16 /16 |
IL25_HUMAN Interleukin-25 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | I17RB_HUMAN Interleukin-17 receptor B[235 aa] | A | 33.3 /32.6 |
12 /15 |
IL25_HUMAN Interleukin-25 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
163 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
NAG
|
A | 100.0 /100.0 |
2 /2 |
interleukin 17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
L |
NAG
|
E | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
G |
NAG
|
A | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
NAG
|
A | 0.0 /62.2 |
2 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
63O
|
A | 80.0 /64.4 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
63Q
|
A | 75.0 /64.2 |
4 /4 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
RMK
|
A | 62.5 /59.6 |
8 /8 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
U5I
|
A | 91.7 /62.4 |
12 /12 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
UTF
|
A | 44.4 /62.7 |
9 /9 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
XCE
|
A | 44.4 /63.4 |
9 /9 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
XCE
|
A | 80.0 /63.4 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
U5Q
|
A | 87.5 /64.7 |
8 /8 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
U5Q
|
A | 100.0 /64.7 |
2 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
U5X
|
A | 100.0 /65.1 |
7 /7 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
63P
|
A | 54.5 /61.4 |
11 /11 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
RMQ
|
A | 58.3 /58.8 |
12 /12 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P |
MLA
|
E | 0.0 /63.1 |
2 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Q |
MLA
|
F | 33.3 /61.4 |
3 /3 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
U6C
|
A | 83.3 /64.2 |
6 /6 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
XCW
|
A | 40.0 /56.9 |
10 /10 |
IL17_HUMAN Interleukin-17A |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
163 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
CA
|
B | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
CD
|
A | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
CD
|
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
J |
CD
|
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
K |
CD
|
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() |
![]() |
L |
CD
|
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
DB |
CD
|
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() |
![]() |
HB |
CD
|
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
IB |
CD
|
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() |
![]() |
G |
MG
|
D | 100.0 /62.0 |
1 /1 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
G |
CL
|
B | 0.0 /62.7 |
1 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
C |
CL
|
A | 0.0 /56.9 |
1 /1 |
IL17_HUMAN Interleukin-17A |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
163 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. | B | 100.0 /100.0 |
2 /2 |
interleukin 17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
3 /3 |
interleukin 17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. | B | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. | F | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. | C | 100.0 /100.0 |
4 /4 |
IL17F_HUMAN Interleukin-17F |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
163 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | interleukin 17F[121 aa] | A | 100.0 /100.0 |
64 /64 |
interleukin 17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | IL17_HUMAN Interleukin-17A[93 aa] | D | 80.0 /64.4 |
30 /41 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL17_HUMAN INTERLEUKIN-17A[80 aa] | A | 80.0 /64.2 |
20 /20 |
IL17_HUMAN INTERLEUKIN-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL17_HUMAN Interleukin-17A[93 aa] | A | 79.3 /62.7 |
29 /41 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | IL17_HUMAN INTERLEUKIN-17A[77 aa] | C | 85.0 /63.2 |
20 /20 |
IL17_HUMAN INTERLEUKIN-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL17_HUMAN Interleukin-17A[10 aa] | A | 0.0 /61.6 |
1 /1 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
B | IL17_HUMAN Interleukin-17A[10 aa] | A | 0.0 /60.0 |
1 /1 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | IL25_HUMAN Interleukin-25[100 aa] | A | 41.7 /32.6 |
12 /12 |
IL25_HUMAN Interleukin-25 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
163 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
H |
SO4
|
C | 100.0 /100.0 |
2 /2 |
interleukin 17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
SO4
|
A | 40.0 /64.2 |
5 /5 |
IL17_HUMAN INTERLEUKIN-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
O |
SO4
|
B | 50.0 /63.2 |
2 /2 |
IL17_HUMAN INTERLEUKIN-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
SO4
|
E | 40.0 /56.2 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P |
SO4
|
E | 0.0 /56.2 |
5 /5 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
SO4
|
D | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
SO4
|
B | 100.0 /60.4 |
2 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
J |
ACY
|
E | 66.7 /63.1 |
3 /3 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
GOL
|
F | 0.0 /62.5 |
3 /3 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
N |
GOL
|
G | 0.0 /59.2 |
1 /1 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
A | 100.0 /65.1 |
2 /2 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
B | 66.7 /62.8 |
3 /3 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
EDO
|
A | 75.0 /63.2 |
4 /4 |
IL17_HUMAN Interleukin-17A |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
A | 100.0 /63.2 |
5 /5 |
IL17_HUMAN Interleukin-17A |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |