HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Summary Bars]	[SiteTable]	Full Bars[95 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
2676554	163	19	Q96PD4(IL17F_HUMAN)	RecName: Full=Interleukin-17F; Short=IL-17F;AltName: Full=Cytokine ML-1;Flags: Precursor;
QUERYSEQ	MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV GCTCVTPVIHHVQ

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q96PD4(IL17F_HUMAN)]

163
	region	name	description
	1-30	SIGNAL
	31-163	CHAIN	/note="Interleukin-17F" /id="PRO_0000015432"
	1-163	DISORDER	predicted by DISOPRED

MONOMER

163

pdb_id a¹ identity[%]² description

6hgo C 100.0 IL17F_HUMAN Interleukin-17F

6hgo A 100.0 IL17F_HUMAN Interleukin-17F

6hgo B 100.0 IL17F_HUMAN Interleukin-17F

1jpy B 100.0 interleukin 17F

1jpy A 100.0 interleukin 17F

6hgo D 100.0 IL17F_HUMAN Interleukin-17F

5n92 B 100.0 IL17F_HUMAN Interleukin-17F

1jpy D 100.0 interleukin 17F

1jpy C 100.0 interleukin 17F

6ppg F 100.0 IL17F_HUMAN Interleukin-17F

5nan F 100.0 IL17F_HUMAN Interleukin-17F

5nan E 100.0 IL17F_HUMAN Interleukin-17F

6hg9 A 100.0 IL17F_HUMAN Interleukin-17F

6ppg A 100.0 IL17F_HUMAN Interleukin-17F

3jvf B 100.0 IL17F_HUMAN Interleukin-17F

6hg4 A 100.0 IL17F_HUMAN Interleukin-17F

3jvf A 100.0 IL17F_HUMAN Interleukin-17F

8ruu F 100.0 IL17F_HUMAN Interleukin-17F

8ruu C 100.0 IL17F_HUMAN Interleukin-17F

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3jvf C I17RA_HUMAN Interleukin-17 receptor A[271 aa] A 100.0
/100.0 16
/16 IL17F_HUMAN Interleukin-17F

3jvf C I17RA_HUMAN Interleukin-17 receptor A[271 aa] B 100.0
/100.0 25
/25 IL17F_HUMAN Interleukin-17F

5nan C I17RA_HUMAN Interleukin-17 receptor A[271 aa] E 100.0
/100.0 28
/28 IL17F_HUMAN Interleukin-17F

5nan B I17RA_HUMAN Interleukin-17 receptor A[271 aa] F 100.0
/100.0 27
/27 IL17F_HUMAN Interleukin-17F

5n92 A IL17_HUMAN Interleukin-17A[109 aa] B 100.0
/100.0 58
/58 IL17F_HUMAN Interleukin-17F

5nan D IL17_HUMAN Interleukin-17A[104 aa] E 100.0
/100.0 50
/50 IL17F_HUMAN Interleukin-17F

5nan A IL17_HUMAN Interleukin-17A[100 aa] F 100.0
/100.0 46
/46 IL17F_HUMAN Interleukin-17F

6hg4 B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 100.0
/100.0 21
/21 IL17F_HUMAN Interleukin-17F

6hg4 B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 100.0
/100.0 16
/16 IL17F_HUMAN Interleukin-17F

6hg4 B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 100.0
/100.0 16
/16 IL17F_HUMAN Interleukin-17F

6hg4 B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 100.0
/100.0 21
/21 IL17F_HUMAN Interleukin-17F

6hg9 B I17RC_HUMAN Interleukin-17 receptor C[423 aa] A 100.0
/100.0 18
/18 IL17F_HUMAN Interleukin-17F

6hg9 B I17RC_HUMAN Interleukin-17 receptor C[423 aa] A 100.0
/100.0 16
/16 IL17F_HUMAN Interleukin-17F

6hg9 B I17RC_HUMAN Interleukin-17 receptor C[423 aa] A 100.0
/100.0 16
/16 IL17F_HUMAN Interleukin-17F

6hg9 B I17RC_HUMAN Interleukin-17 receptor C[423 aa] A 100.0
/100.0 18
/18 IL17F_HUMAN Interleukin-17F

6ppg B Fab MCAF5352A light chain[212 aa] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg E Fab MCAF5352A light chain[216 aa] A 100.0
/100.0 7
/7 IL17F_HUMAN Interleukin-17F

6ppg B Fab MCAF5352A light chain[212 aa] F 100.0
/100.0 6
/6 IL17F_HUMAN Interleukin-17F

6ppg E Fab MCAF5352A light chain[216 aa] F 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg C Fab MCAF5352A heavy chain[223 aa] A 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

6ppg D Fab MCAF5352A heavy chain[226 aa] A 100.0
/100.0 7
/7 IL17F_HUMAN Interleukin-17F

6ppg C Fab MCAF5352A heavy chain[223 aa] F 100.0
/100.0 9
/9 IL17F_HUMAN Interleukin-17F

6ppg D Fab MCAF5352A heavy chain[226 aa] F 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

8ruu A Immunoblobulin heavy chain[219 aa] C 100.0
/100.0 11
/11 IL17F_HUMAN Interleukin-17F

8ruu D Immunoblobulin heavy chain[220 aa] F 100.0
/100.0 11
/11 IL17F_HUMAN Interleukin-17F

8ruu B Immunoblobulin light chain[213 aa] C 100.0
/100.0 11
/11 IL17F_HUMAN Interleukin-17F

8ruu E Immunoblobulin light chain[213 aa] C 100.0
/100.0 6
/6 IL17F_HUMAN Interleukin-17F

8ruu B Immunoblobulin light chain[213 aa] F 100.0
/100.0 4
/4 IL17F_HUMAN Interleukin-17F

8ruu E Immunoblobulin light chain[213 aa] F 100.0
/100.0 13
/13 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 interleukin 17F

1jpy I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. D 100.0
/100.0 2
/2 interleukin 17F

5nan L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. E 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6hgo F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

6hgo G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6hgo H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. D 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

6ppg G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6ppg CB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. F 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

8ruu H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. F 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3jvf E CA
CALCIUM ION[1 atoms] B 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6ppg H CD
CADMIUM ION[1 atoms] A 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6ppg I CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg J CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg K CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg L CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg DB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg EB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6ppg FB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6ppg HB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg IB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy E 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. B 100.0
/100.0 2
/2 interleukin 17F

1jpy F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0 3
/3 interleukin 17F

3jvf D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

6hgo E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

5n92 C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

5nan G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. F 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

8ruu G alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 100.0
/100.0 4
/4 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy B interleukin 17F[121 aa] A 100.0
/100.0 64
/64 interleukin 17F

1jpy A interleukin 17F[121 aa] B 100.0
/100.0 64
/64 interleukin 17F

1jpy D interleukin 17F[120 aa] C 100.0
/100.0 66
/66 interleukin 17F

1jpy C interleukin 17F[117 aa] D 100.0
/100.0 64
/64 interleukin 17F

3jvf B IL17F_HUMAN Interleukin-17F[104 aa] A 100.0
/100.0 38
/38 IL17F_HUMAN Interleukin-17F

3jvf A IL17F_HUMAN Interleukin-17F[104 aa] B 100.0
/100.0 40
/40 IL17F_HUMAN Interleukin-17F

6hg4 A IL17F_HUMAN Interleukin-17F[104 aa] A 100.0
/100.0 45
/45 IL17F_HUMAN Interleukin-17F

6hg4 A IL17F_HUMAN Interleukin-17F[104 aa] A 100.0
/100.0 45
/45 IL17F_HUMAN Interleukin-17F

6hg9 A IL17F_HUMAN Interleukin-17F[109 aa] A 100.0
/100.0 40
/40 IL17F_HUMAN Interleukin-17F

6hg9 A IL17F_HUMAN Interleukin-17F[109 aa] A 100.0
/100.0 40
/40 IL17F_HUMAN Interleukin-17F

6hgo B IL17F_HUMAN Interleukin-17F[122 aa] A 100.0
/100.0 65
/65 IL17F_HUMAN Interleukin-17F

6hgo A IL17F_HUMAN Interleukin-17F[126 aa] B 100.0
/100.0 65
/65 IL17F_HUMAN Interleukin-17F

6hgo D IL17F_HUMAN Interleukin-17F[121 aa] C 100.0
/100.0 66
/66 IL17F_HUMAN Interleukin-17F

6hgo C IL17F_HUMAN Interleukin-17F[127 aa] D 100.0
/100.0 65
/65 IL17F_HUMAN Interleukin-17F

6ppg F IL17F_HUMAN Interleukin-17F[117 aa] A 100.0
/100.0 55
/55 IL17F_HUMAN Interleukin-17F

6ppg A IL17F_HUMAN Interleukin-17F[109 aa] F 100.0
/100.0 51
/51 IL17F_HUMAN Interleukin-17F

8ruu F IL17F_HUMAN Interleukin-17F[102 aa] C 100.0
/100.0 41
/41 IL17F_HUMAN Interleukin-17F

8ruu C IL17F_HUMAN Interleukin-17F[97 aa] F 100.0
/100.0 41
/41 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy H SO4
SULFATE ION[5 atoms] C 100.0
/100.0 2
/2 interleukin 17F

6hgo I SO4
SULFATE ION[5 atoms] D 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
163
	pdb_id	a¹	identity[%]²	description
	6hgo	C	100.0	IL17F_HUMAN Interleukin-17F
	6hgo	A	100.0	IL17F_HUMAN Interleukin-17F
	6hgo	B	100.0	IL17F_HUMAN Interleukin-17F
	1jpy	B	100.0	interleukin 17F
	1jpy	A	100.0	interleukin 17F
	6hgo	D	100.0	IL17F_HUMAN Interleukin-17F
	5n92	B	100.0	IL17F_HUMAN Interleukin-17F
	1jpy	D	100.0	interleukin 17F
	1jpy	C	100.0	interleukin 17F
	6ppg	F	100.0	IL17F_HUMAN Interleukin-17F
	5nan	F	100.0	IL17F_HUMAN Interleukin-17F
	5nan	E	100.0	IL17F_HUMAN Interleukin-17F
	6hg9	A	100.0	IL17F_HUMAN Interleukin-17F
	6ppg	A	100.0	IL17F_HUMAN Interleukin-17F
	3jvf	B	100.0	IL17F_HUMAN Interleukin-17F
	6hg4	A	100.0	IL17F_HUMAN Interleukin-17F
	3jvf	A	100.0	IL17F_HUMAN Interleukin-17F
	8ruu	F	100.0	IL17F_HUMAN Interleukin-17F
	8ruu	C	100.0	IL17F_HUMAN Interleukin-17F
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3jvf	C	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	A	100.0 /100.0	16 /16	IL17F_HUMAN Interleukin-17F
	3jvf	C	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	B	100.0 /100.0	25 /25	IL17F_HUMAN Interleukin-17F
	5nan	C	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	E	100.0 /100.0	28 /28	IL17F_HUMAN Interleukin-17F
	5nan	B	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	F	100.0 /100.0	27 /27	IL17F_HUMAN Interleukin-17F
	5n92	A	IL17_HUMAN Interleukin-17A[109 aa]	B	100.0 /100.0	58 /58	IL17F_HUMAN Interleukin-17F
	5nan	D	IL17_HUMAN Interleukin-17A[104 aa]	E	100.0 /100.0	50 /50	IL17F_HUMAN Interleukin-17F
	5nan	A	IL17_HUMAN Interleukin-17A[100 aa]	F	100.0 /100.0	46 /46	IL17F_HUMAN Interleukin-17F
	6hg4	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	100.0 /100.0	21 /21	IL17F_HUMAN Interleukin-17F
	6hg4	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	100.0 /100.0	16 /16	IL17F_HUMAN Interleukin-17F
	6hg4	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	100.0 /100.0	16 /16	IL17F_HUMAN Interleukin-17F
	6hg4	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	100.0 /100.0	21 /21	IL17F_HUMAN Interleukin-17F
	6hg9	B	I17RC_HUMAN Interleukin-17 receptor C[423 aa]	A	100.0 /100.0	18 /18	IL17F_HUMAN Interleukin-17F
	6hg9	B	I17RC_HUMAN Interleukin-17 receptor C[423 aa]	A	100.0 /100.0	16 /16	IL17F_HUMAN Interleukin-17F
	6hg9	B	I17RC_HUMAN Interleukin-17 receptor C[423 aa]	A	100.0 /100.0	16 /16	IL17F_HUMAN Interleukin-17F
	6hg9	B	I17RC_HUMAN Interleukin-17 receptor C[423 aa]	A	100.0 /100.0	18 /18	IL17F_HUMAN Interleukin-17F
	6ppg	B	Fab MCAF5352A light chain[212 aa]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	E	Fab MCAF5352A light chain[216 aa]	A	100.0 /100.0	7 /7	IL17F_HUMAN Interleukin-17F
	6ppg	B	Fab MCAF5352A light chain[212 aa]	F	100.0 /100.0	6 /6	IL17F_HUMAN Interleukin-17F
	6ppg	E	Fab MCAF5352A light chain[216 aa]	F	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	C	Fab MCAF5352A heavy chain[223 aa]	A	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	6ppg	D	Fab MCAF5352A heavy chain[226 aa]	A	100.0 /100.0	7 /7	IL17F_HUMAN Interleukin-17F
	6ppg	C	Fab MCAF5352A heavy chain[223 aa]	F	100.0 /100.0	9 /9	IL17F_HUMAN Interleukin-17F
	6ppg	D	Fab MCAF5352A heavy chain[226 aa]	F	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	8ruu	A	Immunoblobulin heavy chain[219 aa]	C	100.0 /100.0	11 /11	IL17F_HUMAN Interleukin-17F
	8ruu	D	Immunoblobulin heavy chain[220 aa]	F	100.0 /100.0	11 /11	IL17F_HUMAN Interleukin-17F
	8ruu	B	Immunoblobulin light chain[213 aa]	C	100.0 /100.0	11 /11	IL17F_HUMAN Interleukin-17F
	8ruu	E	Immunoblobulin light chain[213 aa]	C	100.0 /100.0	6 /6	IL17F_HUMAN Interleukin-17F
	8ruu	B	Immunoblobulin light chain[213 aa]	F	100.0 /100.0	4 /4	IL17F_HUMAN Interleukin-17F
	8ruu	E	Immunoblobulin light chain[213 aa]	F	100.0 /100.0	13 /13	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	interleukin 17F
	1jpy	I	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	D	100.0 /100.0	2 /2	interleukin 17F
	5nan	L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	E	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6hgo	F	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	6hgo	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	C	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6hgo	H	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	D	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	6ppg	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg	CB	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	F	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	8ruu	H	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	F	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3jvf	E	CA CALCIUM ION[1 atoms]	B	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg	H	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg	I	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	J	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	K	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	L	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	DB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	EB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg	FB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg	HB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg	IB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy	E	2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-..	B	100.0 /100.0	2 /2	interleukin 17F
	1jpy	F	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	C	100.0 /100.0	3 /3	interleukin 17F
	3jvf	D	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	6hgo	E	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	B	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	5n92	C	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al..	B	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	5nan	G	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be..	F	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	8ruu	G	alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(..	C	100.0 /100.0	4 /4	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy	B	interleukin 17F[121 aa]	A	100.0 /100.0	64 /64	interleukin 17F
	1jpy	A	interleukin 17F[121 aa]	B	100.0 /100.0	64 /64	interleukin 17F
	1jpy	D	interleukin 17F[120 aa]	C	100.0 /100.0	66 /66	interleukin 17F
	1jpy	C	interleukin 17F[117 aa]	D	100.0 /100.0	64 /64	interleukin 17F
	3jvf	B	IL17F_HUMAN Interleukin-17F[104 aa]	A	100.0 /100.0	38 /38	IL17F_HUMAN Interleukin-17F
	3jvf	A	IL17F_HUMAN Interleukin-17F[104 aa]	B	100.0 /100.0	40 /40	IL17F_HUMAN Interleukin-17F
	6hg4	A	IL17F_HUMAN Interleukin-17F[104 aa]	A	100.0 /100.0	45 /45	IL17F_HUMAN Interleukin-17F
	6hg4	A	IL17F_HUMAN Interleukin-17F[104 aa]	A	100.0 /100.0	45 /45	IL17F_HUMAN Interleukin-17F
	6hg9	A	IL17F_HUMAN Interleukin-17F[109 aa]	A	100.0 /100.0	40 /40	IL17F_HUMAN Interleukin-17F
	6hg9	A	IL17F_HUMAN Interleukin-17F[109 aa]	A	100.0 /100.0	40 /40	IL17F_HUMAN Interleukin-17F
	6hgo	B	IL17F_HUMAN Interleukin-17F[122 aa]	A	100.0 /100.0	65 /65	IL17F_HUMAN Interleukin-17F
	6hgo	A	IL17F_HUMAN Interleukin-17F[126 aa]	B	100.0 /100.0	65 /65	IL17F_HUMAN Interleukin-17F
	6hgo	D	IL17F_HUMAN Interleukin-17F[121 aa]	C	100.0 /100.0	66 /66	IL17F_HUMAN Interleukin-17F
	6hgo	C	IL17F_HUMAN Interleukin-17F[127 aa]	D	100.0 /100.0	65 /65	IL17F_HUMAN Interleukin-17F
	6ppg	F	IL17F_HUMAN Interleukin-17F[117 aa]	A	100.0 /100.0	55 /55	IL17F_HUMAN Interleukin-17F
	6ppg	A	IL17F_HUMAN Interleukin-17F[109 aa]	F	100.0 /100.0	51 /51	IL17F_HUMAN Interleukin-17F
	8ruu	F	IL17F_HUMAN Interleukin-17F[102 aa]	C	100.0 /100.0	41 /41	IL17F_HUMAN Interleukin-17F
	8ruu	C	IL17F_HUMAN Interleukin-17F[97 aa]	F	100.0 /100.0	41 /41	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy	H	SO4 SULFATE ION[5 atoms]	C	100.0 /100.0	2 /2	interleukin 17F
	6hgo	I	SO4 SULFATE ION[5 atoms]	D	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Full Bars[95 %]

UniProt Feature Tables [Q96PD4(IL17F_HUMAN)]