Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
17594 | 122 | 4 | P59635(NS7A_SARS) | RecName: Full=ORF7a protein;AltName: Full=Accessory protein 7a;AltName: Full=Protein U122;AltName: Full=Protein X4;Flags: Precursor; |
QUERYSEQ |
MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE |
122 | region | name | description |
1-15 | SIGNAL | ||
16-122 | CHAIN | /note="ORF7a protein" /id="PRO_0000037435" | |
16-96 | TOPO_DOM | /note="Virion surface" | |
97-117 | TRANSMEM | /note="Helical" | |
118-122 | TOPO_DOM | /note="Intravirion" | |
16-81 | DOMAIN | /note="X4e" | |
1-122 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
122 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
1yo4 | A | 100.0 | YX4_CVHSA Hypothetical protein X4 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |