Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1682730 | 498 | 103 | Q13568(IRF5_HUMAN) | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
QUERYSEQ |
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ |
498 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-498 | CHAIN | /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
![]() ![]() ![]() |
14-122 | DNA_BIND | /note="IRF tryptophan pentad repeat" |
![]() ![]() ![]() |
121-207 | REGION | /note="Disordered" |
![]() ![]() |
478-498 | REGION | /note="Disordered" |
![]() ![]() ![]() |
169-206 | COMPBIAS | /note="Pro residues" |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
1-498 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
498 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 99.6 | IRF5_HUMAN Interferon regulatory factor 5 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 47.7 | A8E5I1_DANRE Interferon regulatory factor 10 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
498 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61.. | C | 33.3 /44.3 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | STING_HUMAN Stimulator of interferon genes protein[10 aa] | D | 46.7 /35.2 |
15 /15 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | STING_HUMAN Stimulator of interferon genes protein[4 aa] | D | 0.0 /35.2 |
2 /2 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | STING_HUMAN Stimulator of interferon genes protein[4 aa] | E | 60.0 /35.2 |
5 /5 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | STING_HUMAN Stimulator of interferon genes protein[21 aa] | E | 40.0 /35.2 |
15 /15 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | MAVS peptide[14 aa] | A | 50.0 /35.2 |
12 /13 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | MAVS peptide[16 aa] | B | 36.4 /35.2 |
11 /12 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Phosphorylated TRIF peptide[14 aa] | A | 37.5 /35.2 |
16 /16 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Rotavirus NSP1 peptide[10 aa] | B | 47.1 /35.2 |
17 /17 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Rotavirus NSP1 peptide[10 aa] | E | 42.9 /35.2 |
14 /14 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Rotavirus NSP1 peptide[10 aa] | F | 0.0 /35.2 |
1 /1 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | CBP_HUMAN CREB-binding protein[47 aa] | A | 41.7 /35.7 |
12 /18 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | CBP_HUMAN CREB-binding protein[42 aa] | A | 43.8 /34.9 |
16 /18 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | CBP_HUMAN CREB-binding protein[42 aa] | A | 0.0 /34.9 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | CBP_HUMAN CREB-binding protein[37 aa] | A | 0.0 /34.2 |
1 /1 |
IRF3_MOUSE Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | CBP_HUMAN CREB-binding protein[37 aa] | C | 33.3 /34.9 |
15 /17 |
IRF3_MOUSE Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Q3UDU1_MOUSE Signal transducer and activator of transcription[1.. | A | 23.1 /33.6 |
13 /20 |
IRF9_MOUSE Interferon regulatory factor 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
498 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | DNA (5'-D(P*TP*GP*AP*AP*GP*TP*GP*AP*AP*AP*GP*T)-3'.. | E | 70.0 /47.7 |
10 /10 |
A8E5I1_DANRE Interferon regulatory factor 10 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | DNA (5'-D(P*AP*CP*TP*TP*TP*CP*AP*CP*TP*TP*CP*A)-3'.. | E | 72.7 /47.7 |
11 /11 |
A8E5I1_DANRE Interferon regulatory factor 10 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | GATA-Forward | E | 70.0 /48.0 |
10 /10 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | GATA-Reverse | E | 66.7 /48.0 |
9 /11 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | DNA (5'-D(P*TP*AP*GP*AP*AP*AP*GP*TP*GP*AP*AP*AP*GP.. | A | 70.0 /47.4 |
10 /10 |
Q1RLP9_DANRE Interferon regulatory factor |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | DNA (5'-D(P*GP*CP*TP*TP*TP*CP*AP*CP*TP*TP*TP*CP*TP.. | A | 71.4 /47.4 |
14 /14 |
Q1RLP9_DANRE Interferon regulatory factor |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Interferon-Stimulated Response Elements | C | 70.0 /45.3 |
10 /10 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Interferon-Stimulated Response Elements | C | 55.6 /45.3 |
9 /9 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | DNA (5'-D(*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP*TP*.. | G | 70.0 /46.2 |
10 /11 |
Q99419_HUMAN ICSAT transcription factor |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | DNA (5'-D(P*AP*AP*TP*AP*AP*AP*AP*GP*AP*AP*AP*CP*CP.. | A | 77.8 /45.0 |
9 /9 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | DNA (5'-D(P*TP*TP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. | A | 58.3 /45.0 |
12 /13 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | GAAA-Forward | C | 80.0 /45.3 |
10 /10 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GAAA-Reverse | C | 50.0 /45.3 |
10 /12 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | GACA-Forward | C | 77.8 /44.8 |
9 /9 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GACA-Reverse | C | 54.5 /44.8 |
11 /12 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | GAGA-Forward | C | 75.0 /45.3 |
8 /8 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GAGA-Reverse | C | 54.5 /45.3 |
11 /13 |
F2Z3D5_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 36-MER | C | 45.5 /45.1 |
11 /34 |
TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 34-MER | C | 38.5 /45.1 |
13 /36 |
TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PRDIII-I region of human interferon-B promoter str.. | C | 50.0 /46.9 |
12 /12 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | PRDIII-I region of human interferon-B promoter str.. | C | 54.5 /46.9 |
11 /13 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | DNA (5'-D(P*TP*GP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. | A | 63.6 /45.0 |
11 /13 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | DNA (5'-D(P*AP*TP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. | A | 75.0 /45.0 |
12 /12 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | DNA (5'-D(P*TP*CP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. | A | 81.8 /45.0 |
11 /11 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | DNA (5'-D(P*AP*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP.. | A | 41.7 /45.0 |
12 /13 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 31-MER | C | 55.6 /44.3 |
9 /9 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 31-MER | C | 46.7 /44.3 |
15 /17 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | interferon-b enhancer | C | 50.0 /44.3 |
12 /12 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | interferon-b enhancer | C | 42.9 /44.3 |
14 /16 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. | G | 70.0 /43.9 |
10 /10 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A.. | H | 63.6 /43.9 |
11 /11 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. | I | 70.0 /43.9 |
10 /10 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | DNA (26-MER) | C | 68.2 /42.9 |
22 /22 |
IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1) |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | DNA (26-MER) | C | 50.0 /42.9 |
2 /2 |
IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1) |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
498 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
NA
|
A | 50.0 /41.5 |
4 /4 |
IRF7_MOUSE Interferon regulatory factor 7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
NA
|
A | 50.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
NA
|
A | 40.0 /45.8 |
5 /5 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
ZN
|
A | 0.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
ZN
|
A | 50.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
ZN
|
A | 50.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
ZN
|
A | 25.0 /45.8 |
4 /4 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
CL
|
A | 25.0 /45.8 |
4 /4 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
CL
|
A | 0.0 /45.8 |
1 /1 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
CL
|
A | 25.0 /45.8 |
4 /4 |
Q7Z5G6_HUMAN IRF3 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
CL
|
A | 66.7 /42.1 |
6 /6 |
Q5SUZ4_MOUSE Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
CL
|
A | 16.7 /42.1 |
6 /6 |
Q5SUZ4_MOUSE Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
CL
|
A | 50.0 /42.1 |
2 /2 |
Q5SUZ4_MOUSE Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() |
![]() |
B |
CL
|
A | 0.0 /44.7 |
1 /1 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
K
|
G | 25.0 /43.9 |
4 /4 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
498 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | IRF5_HUMAN Interferon regulatory factor 5[236 aa] | A | 98.4 /99.6 |
62 /62 |
IRF5_HUMAN Interferon regulatory factor 5 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | IRF4_HUMAN Interferon regulatory factor 4[112 aa] | D | 50.0 /45.3 |
2 /2 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() |
![]() |
D | IRF4_HUMAN Interferon regulatory factor 4[109 aa] | E | 0.0 /45.3 |
2 /2 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | IRF3_HUMAN Interferon regulatory factor 3[110 aa] | C | 66.7 /44.3 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | IRF3_HUMAN Interferon regulatory factor 3[110 aa] | E | 0.0 /44.3 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | IRF3_HUMAN Interferon regulatory factor 3[98 aa] | E | 0.0 /45.2 |
1 /1 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | IRF3_HUMAN Interferon regulatory factor 3[239 aa] | A | 12.5 /35.2 |
8 /9 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | IRF3_HUMAN Interferon regulatory factor 3[239 aa] | B | 30.0 /35.2 |
10 /10 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | IRF3_HUMAN Interferon regulatory factor 3[233 aa] | D | 20.0 /35.2 |
20 /20 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | IRF3_MOUSE Interferon regulatory factor 3[194 aa] | A | 40.5 /34.2 |
37 /38 |
IRF3_MOUSE Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | IRF9_MOUSE Interferon regulatory factor 9[189 aa] | A | 9.1 /34.5 |
11 /15 |
IRF9_MOUSE Interferon regulatory factor 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
498 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
PO4
|
A | 0.0 /35.2 |
4 /4 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
PO4
|
A | 0.0 /35.2 |
3 /6 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
PO4
|
A | 0.0 /35.2 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
PO4
|
B | 0.0 /35.2 |
3 /4 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
PO4
|
B | 66.7 /35.2 |
3 /4 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
PO4
|
B | 25.0 /35.2 |
4 /4 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
PO4
|
B | 66.7 /35.2 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
PO4
|
B | 50.0 /35.2 |
2 /2 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
PO4
|
A | 0.0 /34.5 |
5 /5 |
IRF9_MOUSE Interferon regulatory factor 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
E |
PO4
|
B | 0.0 /45.0 |
2 /2 |
IRF4_HUMAN Interferon regulatory factor 4 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
B | 50.0 /41.9 |
2 /2 |
IRF7_MOUSE Interferon regulatory factor 7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
EDO
|
B | 33.3 /41.9 |
3 /3 |
IRF7_MOUSE Interferon regulatory factor 7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
EDO
|
C | 66.7 /41.5 |
3 /5 |
IRF7_MOUSE Interferon regulatory factor 7 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
ACY
|
A | 25.0 /36.7 |
4 /5 |
IRF3_HUMAN Interferon regulatory factor 3 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
MPD
|
A | 0.0 /36.7 |
5 /5 |
IRF3_HUMAN Interferon regulatory factor 3 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |