Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[30 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1613591 75 30 P0DTC4(VEMP_SARS2) RecName: Full=Envelope small membrane protein ; Short=E; Short=sM protein ;
QUERYSEQ
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC4(VEMP_SARS2)]

75
region name description
1-75 CHAIN /note="Envelope small membrane protein" /id="PRO_0000449651"
1-13 TOPO_DOM /note="Virion surface" ECO:0000305|PubMed:32898469"
14-34 TRANSMEM /note="Helical" ECO:0000269|PubMed:33177698, ECO:0000305|PubMed:32898469"
35-75 TOPO_DOM /note="Intravirion" ECO:0000305|PubMed:32898469"
61-75 REGION /note="Disordered"

MONOMER
75
pdb_id a1 identity[%]2 description
2mm4 A 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 E 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 D 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 C 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 B 91.4 VEMP_CVHSA Envelope small membrane protein
5x29 A 91.4 VEMP_CVHSA Envelope small membrane protein
8suz E 100.0 VEMP_SARS2 Envelope small membrane protein
8suz D 100.0 VEMP_SARS2 Envelope small membrane protein
8suz C 100.0 VEMP_SARS2 Envelope small membrane protein
8suz B 100.0 VEMP_SARS2 Envelope small membrane protein
8suz A 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g E 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g D 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g C 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g B 100.0 VEMP_SARS2 Envelope small membrane protein
7k3g A 100.0 VEMP_SARS2 Envelope small membrane protein
8u1t B 100.0 VEMP_SARS2 Envelope small membrane protein
8u1t A 100.0 VEMP_SARS2 Envelope small membrane protein
7qcs C 100.0 VEMP_SARS2 Envelope small membrane protein
7m4r C 100.0 VEMP_SARS2 Envelope small membrane protein
7ntk E 100.0 VEMP_SARS2 Envelope small membrane protein
7qcr D 100.0 VEMP_SARS2 Envelope small membrane protein
7ntk G 100.0 VEMP_SARS2 Envelope small membrane protein
7ntk C 100.0 VEMP_SARS2 Envelope small membrane protein
7ntk H 100.0 VEMP_SARS2 Envelope small membrane protein
7qcr C 100.0 VEMP_SARS2 Envelope small membrane protein
7tuq C 66.7 VEMP_SARS2 Envelope small membrane protein
7qct C 100.0 VEMP_SARS2 Envelope small membrane protein
7qcs D 100.0 VEMP_SARS2 Envelope small membrane protein
7qct D 100.0 VEMP_SARS2 Envelope small membrane protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
75 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7m4r A MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5[360 aa] C 100.0
/100.0
5
/5
VEMP_SARS2 Envelope small membrane protein
7ntk A MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] C 100.0
/100.0
6
/6
VEMP_SARS2 Envelope small membrane protein
7ntk D MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] E 100.0
/100.0
5
/5
VEMP_SARS2 Envelope small membrane protein
7ntk B MPP5_HUMAN MAGUK p55 subfamily member 5[85 aa] G 100.0
/100.0
6
/6
VEMP_SARS2 Envelope small membrane protein
7ntk F MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] H 100.0
/100.0
6
/6
VEMP_SARS2 Envelope small membrane protein
7qcs A PALS1_HUMAN Protein PALS1[97 aa] C 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
7qcs B PALS1_HUMAN Protein PALS1[98 aa] D 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
7qcr A AFAD_HUMAN Afadin[87 aa] C 100.0
/100.0
2
/2
VEMP_SARS2 Envelope small membrane protein
7qcr B AFAD_HUMAN Afadin[86 aa] C 100.0
/100.0
5
/5
VEMP_SARS2 Envelope small membrane protein
7qcr A AFAD_HUMAN Afadin[87 aa] D 100.0
/100.0
5
/5
VEMP_SARS2 Envelope small membrane protein
7qcr B AFAD_HUMAN Afadin[86 aa] D 100.0
/100.0
1
/1
VEMP_SARS2 Envelope small membrane protein
7qct A LNX2_HUMAN Ligand of Numb protein X 2[90 aa] C 100.0
/100.0
5
/5
VEMP_SARS2 Envelope small membrane protein
7qct B LNX2_HUMAN Ligand of Numb protein X 2[90 aa] D 100.0
/100.0
5
/5
VEMP_SARS2 Envelope small membrane protein
7tuq A BRD4_HUMAN Bromodomain-containing protein 4[124 aa] C 66.7
/66.7
3
/3
VEMP_SARS2 Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
75 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k3g B VEMP_SARS2 Envelope small membrane protein[31 aa] A 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
7k3g E VEMP_SARS2 Envelope small membrane protein[31 aa] A 100.0
/100.0
11
/11
VEMP_SARS2 Envelope small membrane protein
7k3g A VEMP_SARS2 Envelope small membrane protein[31 aa] B 100.0
/100.0
11
/11
VEMP_SARS2 Envelope small membrane protein
7k3g C VEMP_SARS2 Envelope small membrane protein[31 aa] B 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
7k3g B VEMP_SARS2 Envelope small membrane protein[31 aa] C 100.0
/100.0
11
/11
VEMP_SARS2 Envelope small membrane protein
7k3g D VEMP_SARS2 Envelope small membrane protein[31 aa] C 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
7k3g C VEMP_SARS2 Envelope small membrane protein[31 aa] D 100.0
/100.0
11
/11
VEMP_SARS2 Envelope small membrane protein
7k3g E VEMP_SARS2 Envelope small membrane protein[31 aa] D 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
7k3g A VEMP_SARS2 Envelope small membrane protein[31 aa] E 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
7k3g D VEMP_SARS2 Envelope small membrane protein[31 aa] E 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
8suz B VEMP_SARS2 Envelope small membrane protein[31 aa] A 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz E VEMP_SARS2 Envelope small membrane protein[31 aa] A 100.0
/100.0
3
/3
VEMP_SARS2 Envelope small membrane protein
8suz A VEMP_SARS2 Envelope small membrane protein[31 aa] B 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz C VEMP_SARS2 Envelope small membrane protein[31 aa] B 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz B VEMP_SARS2 Envelope small membrane protein[31 aa] C 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz D VEMP_SARS2 Envelope small membrane protein[31 aa] C 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz C VEMP_SARS2 Envelope small membrane protein[31 aa] D 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz E VEMP_SARS2 Envelope small membrane protein[31 aa] D 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz A VEMP_SARS2 Envelope small membrane protein[31 aa] E 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8suz D VEMP_SARS2 Envelope small membrane protein[31 aa] E 100.0
/100.0
4
/4
VEMP_SARS2 Envelope small membrane protein
8u1t B VEMP_SARS2 Envelope small membrane protein[26 aa] A 100.0
/100.0
9
/9
VEMP_SARS2 Envelope small membrane protein
8u1t A VEMP_SARS2 Envelope small membrane protein[26 aa] B 100.0
/100.0
9
/9
VEMP_SARS2 Envelope small membrane protein
5x29 B VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/91.4
9
/9
VEMP_CVHSA Envelope small membrane protein
5x29 E VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/91.4
6
/6
VEMP_CVHSA Envelope small membrane protein
5x29 A VEMP_CVHSA Envelope small membrane protein[58 aa] B 100.0
/91.4
9
/9
VEMP_CVHSA Envelope small membrane protein
5x29 C VEMP_CVHSA Envelope small membrane protein[58 aa] B 100.0
/91.4
7
/7
VEMP_CVHSA Envelope small membrane protein
5x29 B VEMP_CVHSA Envelope small membrane protein[58 aa] C 100.0
/91.4
8
/8
VEMP_CVHSA Envelope small membrane protein
5x29 D VEMP_CVHSA Envelope small membrane protein[58 aa] C 100.0
/91.4
7
/7
VEMP_CVHSA Envelope small membrane protein
5x29 C VEMP_CVHSA Envelope small membrane protein[58 aa] D 100.0
/91.4
8
/8
VEMP_CVHSA Envelope small membrane protein
5x29 E VEMP_CVHSA Envelope small membrane protein[58 aa] D 100.0
/91.4
8
/8
VEMP_CVHSA Envelope small membrane protein
5x29 A VEMP_CVHSA Envelope small membrane protein[58 aa] E 100.0
/91.4
8
/8
VEMP_CVHSA Envelope small membrane protein
5x29 D VEMP_CVHSA Envelope small membrane protein[58 aa] E 100.0
/91.4
10
/10
VEMP_CVHSA Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
75 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7ntk M EDO
1,2-ETHANEDIOL[4 atoms]
E 100.0
/100.0
1
/1
VEMP_SARS2 Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.