Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
13076 | 180 | 37 | YP_009725297.1() | |
QUERYSEQ |
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG TDPYEDFQENWNTKHSSGVTRELMRELNGG |
180 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() ![]() |
1-180 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
180 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1AB_SARS2 Host translation inhibitor nsp1 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
180 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | RS2_HUMAN 40S ribosomal protein S2[218 aa] | JA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | uS5[221 aa] | AA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() |
![]() |
DA | RS30_HUMAN 40S ribosomal protein S30[52 aa] | JA | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RS3_HUMAN 40S ribosomal protein S3[225 aa] | JA | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | G1TNM3_RABIT Ribosomal protein S3[228 aa] | AA | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() |
![]() |
I | G1T8A2_RABIT eS30[57 aa] | AA | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | DPOLA_HUMAN DNA polymerase alpha catalytic subunit[1070 aa] | E | 85.7 /88.6 |
14 /14 |
R1A_SARS Non-structural protein 1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
180 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
IA | 18S ribosomal RNA | JA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
WA | 18S ribosomal RNA | HC | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
GA | 18S ribosomal RNA | HA | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
HA | 18S ribosomal RNA | IA | 100.0 /100.0 |
9 /9 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 18S ribosomal RNA | IA | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 18S ribosomal RNA | U | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T | 18S ribosomal RNA | VA | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor Nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | rRNA | AA | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
180 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
QO6
|
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
92G
|
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
OEI
|
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
NT9
|
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
OG3
|
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
OF6
|
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
A1H0G
|
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
A1H0L
|
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
EQT
|
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
FBB
|
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
A1H0K
|
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
A1H0M
|
A | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
A1H0N
|
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
A1H0J
|
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Host translation inhibitor nsp1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
ABV
|
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Host translation inhibitor nsp1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
180 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
KA |
MG
|
JA | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Host translation inhibitor nsp1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |