#WARNING:no index is registered index "YP_009725255.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725255.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
10863 38 0 YP_009725255.1()
QUERYSEQ
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725255.1()]

38
region name description

No homologue is found in PDB.

Please check [SiteTable] for homologues.