PSIBLAST 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Stephen F. Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: uniprot_sprot.fasta 571,282 sequences; 206,678,396 total letters Results from round 1 Query= YP_009725255.1 ORF10 protein [Severe acute respiratory syndrome coronavirus 2] Length=38 Score E Sequences producing significant alignments: (Bits) Value sp|A0A663DJA2|ORF10_SARS2 Putative ORF10 protein OS=Severe acute ... 78.6 5e-21 sp|A6TL10|ASSY_ALKMQ Argininosuccinate synthase OS=Alkaliphilus m... 27.7 2.2 >sp|A0A663DJA2|ORF10_SARS2 Putative ORF10 protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=ORF10 PE=5 SV=1 Length=38 Score = 78.6 bits (192), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%) Query 1 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT 38 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT Sbjct 1 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT 38 >sp|A6TL10|ASSY_ALKMQ Argininosuccinate synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=argG PE=3 SV=1 Length=414 Score = 27.7 bits (60), Expect = 2.2, Method: Composition-based stats. Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%) Query 2 GYINVFAFPFTIYSLLL 18 G+IN+FA P TI +L+L Sbjct 384 GFINLFALPLTIRALML 400 Lambda K H a alpha 0.335 0.145 0.443 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5195398312 Results from round 2 Query= YP_009725255.1 ORF10 protein [Severe acute respiratory syndrome coronavirus 2] Length=38 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|A0A663DJA2|ORF10_SARS2 Putative ORF10 protein OS=Severe acute ... 57.7 8e-13 Sequences not found previously or not previously below threshold: sp|A6TL10|ASSY_ALKMQ Argininosuccinate synthase OS=Alkaliphilus m... 26.4 6.7 >sp|A0A663DJA2|ORF10_SARS2 Putative ORF10 protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=ORF10 PE=5 SV=1 Length=38 Score = 57.7 bits (138), Expect = 8e-13, Method: Composition-based stats. Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%) Query 1 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT 38 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT Sbjct 1 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT 38 >sp|A6TL10|ASSY_ALKMQ Argininosuccinate synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=argG PE=3 SV=1 Length=414 Score = 26.4 bits (57), Expect = 6.7, Method: Composition-based stats. Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%) Query 2 GYINVFAFPFTIYSLLL 18 G+IN+FA P TI +L+L Sbjct 384 GFINLFALPLTIRALML 400 Lambda K H a alpha 0.321 0.155 0.528 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0475 0.140 1.90 42.6 43.6 Effective search space used: 5195398312 Search has CONVERGED! Database: uniprot_sprot.fasta Posted date: Apr 3, 2024 12:05 PM Number of letters in database: 206,678,396 Number of sequences in database: 571,282 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40