#WARNING:no index is registered index 'b'YP_009725309.1'' in 'http://www.uniprot.org/uniprot/' Protein Model on 5nfy_A_1_L_1

Protein Model on 5nfy_A_1_L_1 (TEMPLATE: 5nfy )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [512 aa] Polyprotein 1ab :Q1T6X8_CVHSA
2 b L 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 209L 210C (identity: 100.0 %/92.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5nfy_A_1 identity=92.7%
queryA         3:NVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVG: 102
                :*********** **************** ******************************************************************* ***:
5nfy_A_1      10:NVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVG: 109
SecStr          :   STT B B   S  TTTT SSGGGS GGGEETTEE   TTS   S  EEEE           TT   SB  HHHHHHT SSEEEEEEEEEEE SSB S:    
ExpBur          :eeeeeeeebbeeeebbbeebbeeeeebbeebeeeeeeeeeeeeeeeeebebbbbbeeeeeeeeeeeeeebebeeeebbeebbbbbbbbbbbbebbeebee:    

queryA       103:TNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIG: 202
                :************************* *** * ** ************************************** **************************:
5nfy_A_1     110:TNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIG: 209
SecStr          : EEEEEEEESSS EEEB  EEEEEESSSEEEEE  EE  SSSTTGGGSGGGSS B HHHHHHHHHHHHHHHHTTT SS EEEESSHHHHHHHHTTTB   :    
ExpBur          :bebbbbbbbebeeebbbbbbbbbebeeeeeeeebebeebeeeeeeebeebbeeeeebeebbeebbebbbeebeebeebbbbbbbeeebbbbbbebbbeeb:    

queryA       203:PERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDE: 302
                :********* ******* ******* ** ***************************  ********************************  ********:
5nfy_A_1     210:PERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDE: 309
SecStr          :S  B SSS SB  EEETTTTEEE TTT SS  EE S EEEESGGGT SS HHHHHHTT SSS   SSHHHHHHHHHHHHHHTTTTS   TT      SS :    
ExpBur          :eeeebeebeebbbbbbeeeeebbbbeebeebbbbbbbbbbbbeeeeeeeebeebbeeebeeeeeeeebbbebebbbbbbbbbbbeeebeeebebeeeeeb:    
Contact         :      bb                                                                                            

queryA       303:LKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFD: 402
                :*  * *********** ************************* ************************** * ********************* ******:
5nfy_A_1     310:LRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYAIHHDKFTDGVCLFWNCNVDRYPANAIVCRFD: 409
SecStr          :HHHHHHHHHHHHHHHHHHHHHS  SEEEEET SS   SSTT  SEEEEEESS  STT TTEEE    HHHHTTT  SSEEEEES   SS  SSEEEEEE :    
ExpBur          :eebbebbeebbebbbebbbebeebebbbbbebbebeebbeeeebebebbbeebeeeeeeebeebebbeeebeeebeebbbbbbebebeebbebbbbbbbb:    

queryA       403:TRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMI: 502
                :********************************** ****************           **************************** *********:
5nfy_A_1     410:TRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMI: 509
SecStr          :TT  SSSEEE STT EEEESSSEEEE    GGGGTT EE    EEE S   -----------      SSEEESS SSS   HHHHHHHHHHHHHHHHHH:    
ExpBur          :beeeeebbbebbeebbbbbbebbebbeebeeebbeebeebebbbbbeeeee-----------eeeeeeeebbbebbeeeeebeebbeebeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123