#WARNING:no index is registered index 'b'YP_009725309.1'' in 'http://www.uniprot.org/uniprot/' Protein Model on 5c8s_D_1_O_1

Protein Model on 5c8s_D_1_O_1 (TEMPLATE: 5c8s )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [514 aa] Guanine-N7 methyltransferase :R1AB_CVHSA
2 b O 1 (D) non-polymer(ZN) ZINC ION 207C 210C 226C 229H (identity: 100.0 %/93.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c8s_D_1 identity=93.0%
queryA         1:AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREA: 100
                :************* **************** ******************************************************************* *:
5c8s_D_1       1:AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDA: 100
SecStr          :     STT B B  SS   STT SSTTTS GGGEETTEE   TTS   SS  EEB           TT   SB  HHHHHHTGGGEEEEEEEEEEE SSB:    
ExpBur          :eeeeeebeeebbeeeebbbeeebeeeeebbeebeeeeeeeeeeeeeeeeebebbbbbeeeeeeeeeeeebebebeeeebbebbbbbbbbbbebbebeeeb:    

queryA       101:VGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVK: 200
                :*************************** *** * ** ************************************** ************************:
5c8s_D_1     101:VGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVK: 200
SecStr          : S EEEEEEEESSS EEEB  EEEEE SSSEEEEE  EE  SSGGGGGSHHHHHS B HHHHHHHHHHHHHHHHTTT SS EEEESSHHHHHHHHHHHB :    
ExpBur          :eebebbbbbbbeeeeebbbbbbbbbbbeeeeeeeebebeebebeeeeebeebbeeeeebeebbeebbebbbeebeebbebbbbbbbeeebbbbbbebbbe:    

queryA       201:IGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG: 300
                :*********** ******* ******* ** ***************************  ********************************  ******:
5c8s_D_1     201:IGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG: 300
SecStr          :  S  B SSSSSB  EEETTTTEEE TTT SS  EE S EEEEGGGG  SS HHHHHTTT SSS   SSHHHHHHHHHHHHHHHHHTSS  TT     SS:    
ExpBur          :ebeeeebeeeeebbbbbbeeeeebbbbeebeebbbbbbbbbbbbeeeeeeeebeebbeeebeebeeeeebbbbbebbbbbbbbebbeeeeeeebebeeee:    
Contact         :      b  b               b  b                                                                       

queryA       301:DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCR: 400
                :***  * *********** ************************* **************************** ********************* ****:
5c8s_D_1     301:DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCR: 400
SecStr          :  HHHHHHHHHHHHHHHHHHHHHS  SEEEEET  SS  SSTTS SEEEEE SS  STT TTSB     HHHHTTT  SSEEEEES   SS  TTEEEEE:    
ExpBur          :ebeebeebbeebbebbbebbbebeebebbbbbebbebeebbeeeebebebbbeebeeeeeeebeebebbeeebeeebeebbbbbbebebeebbebbbbbb:    

queryA       401:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNM: 500
                :************************************ ****************           **************************** *******:
5c8s_D_1     401:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNM: 500
SecStr          :E TT  BTTEEE SSS EEE SSS EEE    GGGSTTSEE    EE  S   -----------      TTEESTT  SS   HHHHHHHHHHHHHHHH:    
ExpBur          :bbbeeeeebbbebbeebbbbbbebbebbeeeeeebbebbeebeebbbbeeeee-----------eeebebeebbbeebeeeebbeebbeebeebeebbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123