Protein Model on 1un0_A_1_C_1 (TEMPLATE: 1un0 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [440 aa] IMPORTIN ALPHA SUBUNIT :IMA1_YEAST
2 b C 1 (C) polymer(polypeptide(L)) [16 aa] NUCLEOPORIN NUP2 :NUP2_YEAST 231W 234S 235N 238R 239N(G) 240K 270D 273W 277Y 280D 281G 311T 315R 319N 321V 322T 323G 325D 328T 350N 353K 354E 357W 360S 361N 364A 365G 369Q 396E 399W 403N (identity: 96.8 %/49.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1un0_A_1 identity=49.1%
queryA        81:IVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISE: 180
                :     **     ** **   *  ****  ****  * **  *  * *         * * ************ *** ***  * * ** **        *:
1un0_A_1       5:MTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKE: 104
SecStr          :HHHHTT S HHHHHHHHHHHHHHTT SSS  HHHHHHTT HHHHHHTTSTTS HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHH:    
ExpBur          :bbebbeeeeeeebeebbeebeeebeeeeeebbeebbeeebbeebbebbeeeeeeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbeebeeebee:    

queryA       181:QAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD: 280
                :** ***** ***    ** *    *  * * *       *      *  ********* * * *    * * ****  *    * * * * ******* *:
1un0_A_1     105:QAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD: 199
SecStr          :HHHHHHHHHHTS HHHHHHHHHTT HHHHHHGG-----GS  HHHHHHHHHHHHHHH  STT   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHHTS:    
ExpBur          :bbbebbbebbeeeeebbeebbeeebbebbbebb-----eeeeebbbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeeeeebbbbbbebbbebbe:    
Contact         :                                                  b  bb  bbb                             b  b   b  b

queryA       281:GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVP: 380
                :** * *  *        ** **        ****** ****** * ****** ** *     **  ** ** *** ** ******   *** *    * *:
1un0_A_1     200:GPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP: 299
SecStr          :S HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHTTTTS HHHHHHHHHTT HH:    
ExpBur          :eeeebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbeebbeeebbebbeebbebeebebeebbbebbbebbebebebbeebbebebbe:    
Contact         :b                             b   b   b bbb b  b                     b  bb  b  bb  bb   b           

queryA       381:FLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : **  *  *  ** *** **  *  ***      * ***  * * **  **   *  ** * ***  **    *   *   * *      **  **  **:
1un0_A_1     300:PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKI: 399
SecStr          :HHHHHHHHS HHHHHHHHHHHHHHTTGGGT HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHHHHTT S  HHHHHHHHTTHHHHH:    
ExpBur          :bbbebbeebeeebeeebbebbbbbbebbeeeeebbeebbeeebbebbbebbebeeeebbbbbbebbbbbbebbeebbeeeeeeebebbeebeebebbebb:    
Contact         :               b  b   b                                                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123